Scaffold Ga0307405_10255116

Overview

Basic Information

• Taxon OID: 3300031731
• Scaffold ID: Ga0307405_10255116
• Source Dataset Name: Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1307
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 38.5
  • Long. (^o): -121.7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077757	Metagenome / Metatranscriptome	117	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0307405_102551162	F077757	N/A	MDPNFYNSTISLIIGIFVLSIFSLTDTYSQNSEMSVIVKIIKGDKFLDQIWDINAQLRDKSTDSEISKDQTTFKVNENQTIQLIIPLSNSTQDLNRYSIFVDASSTIDDIDVFGKIDSVKKENNQITLNLSNAR