| Basic Information | |
|---|---|
| Taxon OID | 3300031708 Open in IMG/M |
| Scaffold ID | Ga0310686_118160742 Open in IMG/M |
| Source Dataset Name | FICUS49499 Metagenome Czech Republic combined assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1209 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Czech Republic: South Bohemian Region | |||||||
| Coordinates | Lat. (o) | 49.043 | Long. (o) | 13.6183 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F102190 | Metagenome / Metatranscriptome | 101 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0310686_1181607423 | F102190 | AGGA | VTECVVKPLRDVKVTGSKPVGTKNPTMLRVGVAQAGCD |
| ⦗Top⦘ |