| Basic Information | |
|---|---|
| Taxon OID | 3300031629 Open in IMG/M |
| Scaffold ID | Ga0307985_10133535 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 988 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Ocean | |||||||
| Coordinates | Lat. (o) | -68.5958 | Long. (o) | 78.1913 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012283 | Metagenome / Metatranscriptome | 282 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307985_101335351 | F012283 | AGGAG | LRNWLAVFLALSCSLSSWSDPEIIEYQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGVRFN |
| ⦗Top⦘ |