NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F012283

Metagenome / Metatranscriptome Family F012283

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012283
Family Type Metagenome / Metatranscriptome
Number of Sequences 282
Average Sequence Length 117 residues
Representative Sequence LRNWLAAFLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGIGKFYTQ
Number of Associated Samples 207
Number of Associated Scaffolds 282

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Archaea
% of genes with valid RBS motifs 74.02 %
% of genes near scaffold ends (potentially truncated) 98.58 %
% of genes from short scaffolds (< 2000 bps) 93.62 %
Associated GOLD sequencing projects 189
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (45.035 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(30.142 % of family members)
Environment Ontology (ENVO) Unclassified
(83.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(79.787 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 10.49%    β-sheet: 17.48%    Coil/Unstructured: 72.03%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 282 Family Scaffolds
PF13884Peptidase_S74 2.48
PF136402OG-FeII_Oxy_3 0.71
PF09723Zn-ribbon_8 0.71
PF00622SPRY 0.35
PF13385Laminin_G_3 0.35



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.30 %
UnclassifiedrootN/A22.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000148|SI47jul10_100mDRAFT_c1034627All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon721Open in IMG/M
3300000212|SI47jul10_120mDRAFT_c1058300Not Available580Open in IMG/M
3300001974|GOS2246_10012612Not Available1489Open in IMG/M
3300001974|GOS2246_10099263All Organisms → Viruses → Predicted Viral1449Open in IMG/M
3300002231|KVRMV2_100404117All Organisms → Viruses → Predicted Viral2336Open in IMG/M
3300003500|JGI26242J51144_1038136All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300003500|JGI26242J51144_1067556All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300004280|Ga0066606_10234309All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300004448|Ga0065861_1179269All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon635Open in IMG/M
3300004951|Ga0068513_1025270All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300004951|Ga0068513_1041584All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon506Open in IMG/M
3300005239|Ga0073579_1175653All Organisms → Viruses → Predicted Viral4987Open in IMG/M
3300005427|Ga0066851_10100508All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300005433|Ga0066830_10072670All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300005837|Ga0078893_10761668All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300005837|Ga0078893_10887998All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon686Open in IMG/M
3300006029|Ga0075466_1038650All Organisms → Viruses → Predicted Viral1454Open in IMG/M
3300006090|Ga0082015_1060608All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon597Open in IMG/M
3300006091|Ga0082018_1050535All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300006164|Ga0075441_10251191All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon651Open in IMG/M
3300006165|Ga0075443_10008998All Organisms → cellular organisms → Bacteria3484Open in IMG/M
3300006166|Ga0066836_10242986All Organisms → Viruses → Predicted Viral1073Open in IMG/M
3300006166|Ga0066836_10958731Not Available516Open in IMG/M
3300006190|Ga0075446_10048391All Organisms → cellular organisms → Bacteria1323Open in IMG/M
3300006190|Ga0075446_10074034All Organisms → Viruses → Predicted Viral1022Open in IMG/M
3300006191|Ga0075447_10117764Not Available910Open in IMG/M
3300006191|Ga0075447_10141818All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon811Open in IMG/M
3300006308|Ga0068470_1066974All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon640Open in IMG/M
3300006310|Ga0068471_1339471All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon908Open in IMG/M
3300006339|Ga0068481_1150696All Organisms → Viruses → Predicted Viral1152Open in IMG/M
3300006352|Ga0075448_10184060All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300006736|Ga0098033_1055032All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1164Open in IMG/M
3300006737|Ga0098037_1100163All Organisms → Viruses → Predicted Viral1004Open in IMG/M
3300006738|Ga0098035_1236310All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300006752|Ga0098048_1006451All Organisms → Viruses → Predicted Viral4405Open in IMG/M
3300006752|Ga0098048_1137994All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300006752|Ga0098048_1177443All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300006753|Ga0098039_1233484All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon620Open in IMG/M
3300006753|Ga0098039_1244644All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon603Open in IMG/M
3300006754|Ga0098044_1178707All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon841Open in IMG/M
3300006789|Ga0098054_1091481All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300006789|Ga0098054_1170615All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300006789|Ga0098054_1191462All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300006789|Ga0098054_1197286All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300006793|Ga0098055_1178594All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300006793|Ga0098055_1205021All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300006793|Ga0098055_1220765All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300006793|Ga0098055_1229263All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300006916|Ga0070750_10284424All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300006916|Ga0070750_10401210All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300006920|Ga0070748_1072735All Organisms → Viruses → Predicted Viral1336Open in IMG/M
3300006920|Ga0070748_1092804All Organisms → Viruses → Predicted Viral1155Open in IMG/M
3300006920|Ga0070748_1112749All Organisms → Viruses → Predicted Viral1030Open in IMG/M
3300006921|Ga0098060_1183392All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300006921|Ga0098060_1193378All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300006921|Ga0098060_1220098All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon516Open in IMG/M
3300006922|Ga0098045_1041929All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1150Open in IMG/M
3300006923|Ga0098053_1048393All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300006923|Ga0098053_1123689All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon518Open in IMG/M
3300006924|Ga0098051_1043693All Organisms → Viruses → Predicted Viral1249Open in IMG/M
3300006925|Ga0098050_1069688All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300006925|Ga0098050_1105420All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300006925|Ga0098050_1153648All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300006928|Ga0098041_1019637All Organisms → Viruses → Predicted Viral2210Open in IMG/M
3300006929|Ga0098036_1028632All Organisms → Viruses → Predicted Viral1752Open in IMG/M
3300006929|Ga0098036_1103913All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300006929|Ga0098036_1182435All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon639Open in IMG/M
3300006990|Ga0098046_1056172All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300006990|Ga0098046_1139613All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon522Open in IMG/M
3300008050|Ga0098052_1230851All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon711Open in IMG/M
3300008050|Ga0098052_1260928All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon661Open in IMG/M
3300008221|Ga0114916_1065240All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon964Open in IMG/M
3300008253|Ga0105349_10118639All Organisms → Viruses → Predicted Viral1106Open in IMG/M
3300009080|Ga0102815_10566430Not Available637Open in IMG/M
3300009420|Ga0114994_10436465All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon865Open in IMG/M
3300009705|Ga0115000_10516105All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon751Open in IMG/M
3300009785|Ga0115001_10674547All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon628Open in IMG/M
3300010149|Ga0098049_1076083All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1058Open in IMG/M
3300010153|Ga0098059_1249609All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon684Open in IMG/M
3300017702|Ga0181374_1040346All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon807Open in IMG/M
3300017713|Ga0181391_1050232All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon986Open in IMG/M
3300017719|Ga0181390_1078650Not Available914Open in IMG/M
3300017720|Ga0181383_1026348All Organisms → Viruses → Predicted Viral1565Open in IMG/M
3300017724|Ga0181388_1104771Not Available673Open in IMG/M
3300017725|Ga0181398_1153666All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon545Open in IMG/M
3300017727|Ga0181401_1058742All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1036Open in IMG/M
3300017729|Ga0181396_1066958All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon720Open in IMG/M
3300017729|Ga0181396_1069852Not Available705Open in IMG/M
3300017731|Ga0181416_1055844Not Available932Open in IMG/M
3300017731|Ga0181416_1143230All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon576Open in IMG/M
3300017740|Ga0181418_1118292All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon641Open in IMG/M
3300017743|Ga0181402_1038364All Organisms → Viruses → Predicted Viral1316Open in IMG/M
3300017744|Ga0181397_1128002All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon657Open in IMG/M
3300017749|Ga0181392_1159857All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon658Open in IMG/M
3300017749|Ga0181392_1168905All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon638Open in IMG/M
3300017751|Ga0187219_1115847All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon799Open in IMG/M
3300017753|Ga0181407_1189211All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon500Open in IMG/M
3300017756|Ga0181382_1070928All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon973Open in IMG/M
3300017756|Ga0181382_1157637All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon589Open in IMG/M
3300017759|Ga0181414_1046699All Organisms → Viruses → Predicted Viral1161Open in IMG/M
3300017760|Ga0181408_1177836Not Available544Open in IMG/M
3300017762|Ga0181422_1063172All Organisms → Viruses → Predicted Viral1179Open in IMG/M
3300017764|Ga0181385_1053519All Organisms → Viruses → Predicted Viral1255Open in IMG/M
3300017764|Ga0181385_1182047Not Available635Open in IMG/M
3300017767|Ga0181406_1161977Not Available670Open in IMG/M
3300017770|Ga0187217_1159611All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon753Open in IMG/M
3300017775|Ga0181432_1102852All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon852Open in IMG/M
3300017775|Ga0181432_1173148Not Available670Open in IMG/M
3300017776|Ga0181394_1014261All Organisms → Viruses → Predicted Viral2954Open in IMG/M
3300017776|Ga0181394_1061767All Organisms → Viruses → Predicted Viral1242Open in IMG/M
3300017776|Ga0181394_1127269Not Available801Open in IMG/M
3300017782|Ga0181380_1026187All Organisms → Viruses → Predicted Viral2153Open in IMG/M
3300017782|Ga0181380_1320050All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon505Open in IMG/M
3300017783|Ga0181379_1070148All Organisms → Viruses → Predicted Viral1312Open in IMG/M
3300017786|Ga0181424_10385159Not Available572Open in IMG/M
3300017786|Ga0181424_10411823All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon549Open in IMG/M
3300019742|Ga0193965_1037241All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon848Open in IMG/M
3300020389|Ga0211680_10335267All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon555Open in IMG/M
3300020407|Ga0211575_10322020All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon640Open in IMG/M
3300020438|Ga0211576_10561213All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon572Open in IMG/M
3300021085|Ga0206677_10365734All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon556Open in IMG/M
3300021089|Ga0206679_10534061Not Available608Open in IMG/M
3300021342|Ga0206691_1897813All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon926Open in IMG/M
3300021359|Ga0206689_10969586All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon776Open in IMG/M
3300021359|Ga0206689_11045039Not Available654Open in IMG/M
3300021371|Ga0213863_10212455Not Available846Open in IMG/M
3300021378|Ga0213861_10536094Not Available548Open in IMG/M
3300021442|Ga0206685_10173282All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon723Open in IMG/M
3300021791|Ga0226832_10274144All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon681Open in IMG/M
3300021957|Ga0222717_10686214All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon525Open in IMG/M
3300021958|Ga0222718_10050708All Organisms → Viruses → Predicted Viral2637Open in IMG/M
3300021959|Ga0222716_10613798All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon591Open in IMG/M
3300022065|Ga0212024_1065397All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon644Open in IMG/M
3300022178|Ga0196887_1109417Not Available607Open in IMG/M
3300022220|Ga0224513_10201766Not Available780Open in IMG/M
3300022306|Ga0224509_10392953Not Available511Open in IMG/M
3300022308|Ga0224504_10459610All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon531Open in IMG/M
(restricted) 3300023112|Ga0233411_10229759Not Available615Open in IMG/M
3300023676|Ga0232114_132638All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon513Open in IMG/M
3300023683|Ga0228681_1034691All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon594Open in IMG/M
(restricted) 3300024059|Ga0255040_10073951All Organisms → Viruses → Predicted Viral1294Open in IMG/M
3300024235|Ga0228665_1127138Not Available524Open in IMG/M
(restricted) 3300024264|Ga0233444_10468456All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon508Open in IMG/M
3300024344|Ga0209992_10218696All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon802Open in IMG/M
3300024346|Ga0244775_11440896Not Available528Open in IMG/M
3300024348|Ga0244776_10503522All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon782Open in IMG/M
3300024420|Ga0228632_1030982All Organisms → Viruses → Predicted Viral1243Open in IMG/M
(restricted) 3300024519|Ga0255046_10171705Not Available972Open in IMG/M
(restricted) 3300024520|Ga0255047_10293056Not Available824Open in IMG/M
3300025043|Ga0207907_126224All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300025045|Ga0207901_1046190All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon579Open in IMG/M
3300025046|Ga0207902_1033334All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon633Open in IMG/M
3300025066|Ga0208012_1057991Not Available556Open in IMG/M
3300025069|Ga0207887_1060654All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon618Open in IMG/M
3300025083|Ga0208791_1023886All Organisms → cellular organisms → Archaea1209Open in IMG/M
3300025083|Ga0208791_1056788All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon670Open in IMG/M
3300025084|Ga0208298_1083169All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon593Open in IMG/M
3300025084|Ga0208298_1097203All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon536Open in IMG/M
3300025085|Ga0208792_1034713All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon989Open in IMG/M
3300025085|Ga0208792_1064299Not Available670Open in IMG/M
3300025098|Ga0208434_1059465All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon817Open in IMG/M
3300025098|Ga0208434_1079698All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon668Open in IMG/M
3300025098|Ga0208434_1098642All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon574Open in IMG/M
3300025099|Ga0208669_1004681All Organisms → Viruses → Predicted Viral4299Open in IMG/M
3300025099|Ga0208669_1056581Not Available884Open in IMG/M
3300025099|Ga0208669_1091995Not Available641Open in IMG/M
3300025108|Ga0208793_1010108All Organisms → Viruses → Predicted Viral3763Open in IMG/M
3300025108|Ga0208793_1082941All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon922Open in IMG/M
3300025108|Ga0208793_1116706All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon733Open in IMG/M
3300025108|Ga0208793_1129145All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon684Open in IMG/M
3300025108|Ga0208793_1152492All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon610Open in IMG/M
3300025108|Ga0208793_1172115All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon559Open in IMG/M
3300025110|Ga0208158_1106545All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon656Open in IMG/M
3300025128|Ga0208919_1006237All Organisms → Viruses5266Open in IMG/M
3300025128|Ga0208919_1040458All Organisms → Viruses → Predicted Viral1639Open in IMG/M
3300025128|Ga0208919_1071733All Organisms → Viruses → Predicted Viral1150Open in IMG/M
3300025128|Ga0208919_1089388All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1001Open in IMG/M
3300025128|Ga0208919_1172871Not Available660Open in IMG/M
3300025128|Ga0208919_1224594All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon554Open in IMG/M
3300025133|Ga0208299_1048663All Organisms → Viruses → Predicted Viral1630Open in IMG/M
3300025168|Ga0209337_1194869Not Available830Open in IMG/M
3300025276|Ga0208814_1114462All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon656Open in IMG/M
3300025623|Ga0209041_1088339Not Available858Open in IMG/M
3300025632|Ga0209194_1141063All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon575Open in IMG/M
3300025652|Ga0208134_1008892All Organisms → Viruses → Predicted Viral4351Open in IMG/M
3300025652|Ga0208134_1044078All Organisms → Viruses → Predicted Viral1462Open in IMG/M
3300025652|Ga0208134_1057681All Organisms → Viruses → Predicted Viral1202Open in IMG/M
3300025665|Ga0209360_1143799Not Available663Open in IMG/M
3300025667|Ga0209043_1029009All Organisms → Viruses → Predicted Viral1851Open in IMG/M
3300025676|Ga0209657_1158422Not Available632Open in IMG/M
3300025769|Ga0208767_1095940All Organisms → Viruses → Predicted Viral1201Open in IMG/M
3300025770|Ga0209362_1086373All Organisms → Viruses → Predicted Viral1205Open in IMG/M
3300025822|Ga0209714_1087045All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon896Open in IMG/M
3300025869|Ga0209308_10258756All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon743Open in IMG/M
3300025873|Ga0209757_10159097Not Available709Open in IMG/M
3300025889|Ga0208644_1291480All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon653Open in IMG/M
3300025892|Ga0209630_10404150All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon590Open in IMG/M
3300026115|Ga0208560_1002794All Organisms → Viruses → Predicted Viral1431Open in IMG/M
3300026201|Ga0208127_1069237All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon977Open in IMG/M
3300026213|Ga0208131_1101295All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon698Open in IMG/M
3300026420|Ga0247581_1018728All Organisms → Viruses → Predicted Viral1030Open in IMG/M
3300026448|Ga0247594_1052148Not Available703Open in IMG/M
3300026458|Ga0247578_1041021Not Available879Open in IMG/M
3300026461|Ga0247600_1069111Not Available692Open in IMG/M
3300026465|Ga0247588_1081594All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon644Open in IMG/M
3300026506|Ga0228604_1035638Not Available762Open in IMG/M
3300026513|Ga0247590_1154529Not Available588Open in IMG/M
3300026517|Ga0228607_1138254All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon594Open in IMG/M
3300027233|Ga0208678_1103108All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon532Open in IMG/M
3300027413|Ga0208950_1035802All Organisms → Viruses → Predicted Viral1306Open in IMG/M
3300027522|Ga0209384_1057156All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1030Open in IMG/M
3300027572|Ga0208964_1120268Not Available563Open in IMG/M
3300027630|Ga0209432_1223302All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon524Open in IMG/M
3300027668|Ga0209482_1066037All Organisms → Viruses → Predicted Viral1256Open in IMG/M
3300027668|Ga0209482_1169027Not Available629Open in IMG/M
3300027672|Ga0209383_1114679All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon882Open in IMG/M
3300027686|Ga0209071_1064014All Organisms → Viruses → Predicted Viral1100Open in IMG/M
3300027704|Ga0209816_1068050Not Available1510Open in IMG/M
3300027704|Ga0209816_1234757Not Available587Open in IMG/M
3300027753|Ga0208305_10284670Not Available581Open in IMG/M
3300027779|Ga0209709_10224733All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon853Open in IMG/M
(restricted) 3300027865|Ga0255052_10197086All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon984Open in IMG/M
(restricted) 3300027881|Ga0255055_10619685All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon579Open in IMG/M
3300027906|Ga0209404_11108524Not Available544Open in IMG/M
3300028102|Ga0247586_1040983All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon870Open in IMG/M
3300028119|Ga0247561_105418All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon931Open in IMG/M
3300028134|Ga0256411_1283998All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon503Open in IMG/M
3300028136|Ga0228608_1205685Not Available512Open in IMG/M
3300028196|Ga0257114_1215170Not Available702Open in IMG/M
3300028277|Ga0257116_1107607Not Available726Open in IMG/M
3300028330|Ga0247601_1054667All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon538Open in IMG/M
3300028335|Ga0247566_1067586Not Available599Open in IMG/M
3300028396|Ga0228643_1044133All Organisms → Viruses → Predicted Viral1120Open in IMG/M
3300028488|Ga0257113_1173358All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon641Open in IMG/M
3300028535|Ga0257111_1110800Not Available861Open in IMG/M
3300031141|Ga0308021_10235912All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon695Open in IMG/M
3300031167|Ga0308023_1066968Not Available676Open in IMG/M
3300031519|Ga0307488_10257073All Organisms → Viruses → Predicted Viral1148Open in IMG/M
3300031569|Ga0307489_11143357All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon560Open in IMG/M
3300031608|Ga0307999_1001461Not Available6505Open in IMG/M
3300031608|Ga0307999_1014989All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1956Open in IMG/M
3300031608|Ga0307999_1056556All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon925Open in IMG/M
3300031629|Ga0307985_10007152Not Available5863Open in IMG/M
3300031629|Ga0307985_10073228All Organisms → Viruses → Predicted Viral1388Open in IMG/M
3300031629|Ga0307985_10133535All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon988Open in IMG/M
3300031644|Ga0308001_10300489All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon604Open in IMG/M
3300031658|Ga0307984_1003930Not Available5866Open in IMG/M
3300031658|Ga0307984_1073608All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1026Open in IMG/M
3300031658|Ga0307984_1230657All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon500Open in IMG/M
3300031660|Ga0307994_1058255All Organisms → Viruses → Predicted Viral1497Open in IMG/M
3300031683|Ga0308006_10105243Not Available867Open in IMG/M
3300031683|Ga0308006_10229573All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon578Open in IMG/M
3300031687|Ga0308008_1171559All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon502Open in IMG/M
3300031688|Ga0308011_10003779All Organisms → Viruses6115Open in IMG/M
3300031688|Ga0308011_10034628All Organisms → Viruses → Predicted Viral1662Open in IMG/M
3300031689|Ga0308017_1036196All Organisms → Viruses → Predicted Viral1071Open in IMG/M
3300031703|Ga0308002_1019179All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1673Open in IMG/M
3300031703|Ga0308002_1037469Not Available1130Open in IMG/M
3300031703|Ga0308002_1081442All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon706Open in IMG/M
3300031705|Ga0308003_1159112All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon692Open in IMG/M
3300031721|Ga0308013_10269763All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon606Open in IMG/M
3300031757|Ga0315328_10062498All Organisms → Viruses → Predicted Viral2097Open in IMG/M
3300031766|Ga0315322_10704663All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon634Open in IMG/M
3300031775|Ga0315326_10269688Not Available1116Open in IMG/M
3300031886|Ga0315318_10523164All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon675Open in IMG/M
3300031886|Ga0315318_10713687All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon563Open in IMG/M
3300031886|Ga0315318_10775520All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon535Open in IMG/M
3300032011|Ga0315316_10831123All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon760Open in IMG/M
3300032019|Ga0315324_10372528All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon514Open in IMG/M
3300032048|Ga0315329_10217903All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1005Open in IMG/M
3300032073|Ga0315315_11615371Not Available558Open in IMG/M
3300032073|Ga0315315_11910986All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon501Open in IMG/M
3300032088|Ga0315321_10528992All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon710Open in IMG/M
3300032278|Ga0310345_12363845All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.513Open in IMG/M
3300032360|Ga0315334_10406880All Organisms → Viruses → Predicted Viral1153Open in IMG/M
3300032373|Ga0316204_10571487Not Available833Open in IMG/M
3300032820|Ga0310342_100804049All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1088Open in IMG/M
3300032820|Ga0310342_102802275All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon582Open in IMG/M
3300033742|Ga0314858_033301All Organisms → Viruses → Predicted Viral1198Open in IMG/M
3300033742|Ga0314858_048701All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1022Open in IMG/M
3300034375|Ga0348336_190313Not Available560Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine30.14%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater13.48%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine8.51%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater7.45%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.38%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater5.67%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.96%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine4.61%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.42%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.42%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.77%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.06%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.06%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.06%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.06%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.06%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.71%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.71%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine0.71%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.71%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.71%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.71%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.71%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat0.35%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic0.35%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.35%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.35%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.35%
Methane Seep MesocosmEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm0.35%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.35%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.35%
Hydrothermal Vent FluidsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids0.35%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.35%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.35%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000148Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100mEnvironmentalOpen in IMG/M
3300000212Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 120mEnvironmentalOpen in IMG/M
3300001974Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031EnvironmentalOpen in IMG/M
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300003500Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNAEnvironmentalOpen in IMG/M
3300004280Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100mEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004951Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVsEnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005427Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65EnvironmentalOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006090Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124EnvironmentalOpen in IMG/M
3300006091Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP125EnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006166Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91EnvironmentalOpen in IMG/M
3300006190Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNAEnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006308Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500mEnvironmentalOpen in IMG/M
3300006310Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500mEnvironmentalOpen in IMG/M
3300006339Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500mEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006736Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006738Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006753Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006923Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008221Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66EnvironmentalOpen in IMG/M
3300008253Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson CanyonEnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300017702Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaGEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300019742Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_8_MGEnvironmentalOpen in IMG/M
3300020389Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008)EnvironmentalOpen in IMG/M
3300020407Marine microbial communities from Tara Oceans - TARA_B100001105 (ERX556033-ERR599115)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021089Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021442Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015EnvironmentalOpen in IMG/M
3300021791Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmerEnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022220Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21EnvironmentalOpen in IMG/M
3300022306Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022308Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24EnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300023676Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 55R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023683Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024235Seawater microbial communities from Monterey Bay, California, United States - 79DEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024420Seawater microbial communities from Monterey Bay, California, United States - 40DEnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300025043Marine viral communities from the Subarctic Pacific Ocean - LP-52 (SPAdes)EnvironmentalOpen in IMG/M
3300025045Marine viral communities from the Pacific Ocean - LP-46 (SPAdes)EnvironmentalOpen in IMG/M
3300025046Marine viral communities from the Pacific Ocean - LP-45 (SPAdes)EnvironmentalOpen in IMG/M
3300025066Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025069Marine viral communities from the Pacific Ocean - LP-38 (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025623Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025632Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025665Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025667Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025676Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025770Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025822Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025873Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026115Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 (SPAdes)EnvironmentalOpen in IMG/M
3300026201Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 (SPAdes)EnvironmentalOpen in IMG/M
3300026213Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 (SPAdes)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026506Seawater microbial communities from Monterey Bay, California, United States - 4DEnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026517Seawater microbial communities from Monterey Bay, California, United States - 8DEnvironmentalOpen in IMG/M
3300027233Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027413Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027522Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027572Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_08_M0_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027630Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_800m (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027672Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027686Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027865 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21EnvironmentalOpen in IMG/M
3300027881 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028119Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 9R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028136Seawater microbial communities from Monterey Bay, California, United States - 9DEnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028277Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_120mEnvironmentalOpen in IMG/M
3300028330Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 76R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028396Seawater microbial communities from Monterey Bay, California, United States - 55DEnvironmentalOpen in IMG/M
3300028488Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320mEnvironmentalOpen in IMG/M
3300028489Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000mEnvironmentalOpen in IMG/M
3300028535Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_500mEnvironmentalOpen in IMG/M
3300031141Marine microbial communities from water near the shore, Antarctic Ocean - #351EnvironmentalOpen in IMG/M
3300031167Marine microbial communities from water near the shore, Antarctic Ocean - #418EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031608Marine microbial communities from water near the shore, Antarctic Ocean - #1EnvironmentalOpen in IMG/M
3300031629Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80EnvironmentalOpen in IMG/M
3300031644Marine microbial communities from water near the shore, Antarctic Ocean - #5EnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031660Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261EnvironmentalOpen in IMG/M
3300031683Marine microbial communities from water near the shore, Antarctic Ocean - #69EnvironmentalOpen in IMG/M
3300031687Marine microbial communities from water near the shore, Antarctic Ocean - #125EnvironmentalOpen in IMG/M
3300031688Marine microbial communities from water near the shore, Antarctic Ocean - #177EnvironmentalOpen in IMG/M
3300031689Marine microbial communities from water near the shore, Antarctic Ocean - #280EnvironmentalOpen in IMG/M
3300031703Marine microbial communities from water near the shore, Antarctic Ocean - #34EnvironmentalOpen in IMG/M
3300031705Marine microbial communities from water near the shore, Antarctic Ocean - #36EnvironmentalOpen in IMG/M
3300031721Marine microbial communities from water near the shore, Antarctic Ocean - #181EnvironmentalOpen in IMG/M
3300031757Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031775Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315EnvironmentalOpen in IMG/M
3300031886Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032019Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 21515EnvironmentalOpen in IMG/M
3300032048Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032278Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300032360Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915EnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SI47jul10_100mDRAFT_103462713300000148MarineLALSCSLSSWSNPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGVGRFYTQGDETFQKYMWEDLSEYYLPNSRNTFDLTIYPMGNIDVNYEE
SI47jul10_120mDRAFT_105830013300000212MarineLRNWLAVLLALSCSLSSWSNPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGVGRFY
GOS2246_1001261213300001974MarineLLCSQPKADAPIIEHTIADDGWVEVPLDFTFPFWGNSYTTSFMFSNGVVGFISPNDIPGTGIVNDGLCCSGIDFENATYSSMSSQGYGGVRFDFTIMPWHTDLIDTGPGHFYTQGDSTYQKYMWEAVDEYYQTARENTFDLTIYPLGNIHMTYQELDIANH
GOS2246_1009926333300001974MarineMALLVSCLSLFWSAKADAPIVEHQIADDQWVEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFNYTIMPWHTDLI
KVRMV2_10040411713300002231Marine SedimentLKSWLVAFLVLSCSLSSWSNPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDETFQKYMWENLSEYYDRNTSNSFDLTIYPMGNIDVNYEQVQINT
JGI26242J51144_103813613300003500MarineLRNLLTVLLALFFSLYSWADPEVIEHQISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVAGSGIVYDGLCCDGQNLSSFTGVRFNYTIMPWNTDLIDI
JGI26242J51144_106755613300003500MarineLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFT
Ga0066606_1023430913300004280MarineLRNWLAVLLALSCSLSSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQNLSSFTGVRFNYTIMPWNTDLI
Ga0065861_117926923300004448MarineLRNWLAAFLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNRYVTSFMFSNGVVGFLDPNDVPGSGYIYDGLCCDGPDLTSFTGVRFNYT
Ga0068513_102527013300004951Marine WaterLKSWLVAFLVLSCSLSSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVDGTGYIHDGLCCSGQDFASGATGVRFHYTIMPWHTDLIDTGVG
Ga0068513_104158413300004951Marine WaterVLFFSLSSLSDAPIIEHQISDDGWVEVPLDFTFPFYGNTYVTSFMFSNGVVGFLDPLDVPGSGYIHDGLCCNGQDFSSGATGVRFNYTIMPWHTDLIDTGPGRFYTQGDSTYQKYM
Ga0073579_117565363300005239MarineLRNWLAVLLALSCSLSSWSDPEIVEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGV
Ga0066851_1010050823300005427MarineLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIHDGLCCHGQNFAN
Ga0066830_1007267013300005433MarineLRNWLVAFLALSFSLFSWSDPEIVEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVHDGLCCNGPDFSSGATGVRFNYTIMPWHTDLIDTGIGRFYTQGDET
Ga0078893_1076166823300005837Marine Surface WaterVALLVLCFSLSSSSDPEIVEHQISDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVDGTGYIHDGLCCNGEDFASGATGVRFHYTIMPWHT
Ga0078893_1088799813300005837Marine Surface WaterVCCFSLSSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFFDPLDVDGTGYIHDGLCCSGQDFASGATGVRFHYTIMPWHTDLIDTGIGRFYTQGDETYQKYMWKDLSEYYDRNTSNTF
Ga0075466_103865033300006029AqueousLRNWLAVLLALSCSLSSWSDPEIIEHQIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDSTFQKYMWENLSEYYNRNTSNT
Ga0082015_106060813300006090MarineVFLALFFLLCSQLKADAPIIEHTIVDDGWVEVPLDFTFPYWGNTYTTSFMFANGVVGFISPNDIPGTGIVNDGLCCQGYDLENVAYADMNYGGSYGGVRFDFTIMPWHTDLIDTGPGHFYTQGDTTFQKYMWEAVDEYYQTSRENTFDL
Ga0082018_105053513300006091MarineMVFLVSFFLLCSQSKADAPIVEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFNYTIMPWHTDLIDTGAGRFYTQGDSTFQKYMWENLAEYYNAATSNT
Ga0075441_1025119113300006164MarineMVLWVSFFLLSSSSKAAEIEEVFIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVDGTGYIHDGLCCNGEDFISGAQGVRFHYTIMPWHTDLIDTGTGRFYTQGDSTYQKYMWENIAEYRYPDRENSFDLT
Ga0075443_1000899853300006165MarineLRNWLAAFLALSCSLSSWSDPEIIEYQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGAT
Ga0066836_1024298613300006166MarineLALSFSLFSFSDPEIVEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIHDGLCCSGQDFANGASGVRFNYTIMPWHTDLIDTGIGRFYTQGDSTFQK
Ga0066836_1095873123300006166MarineLKSWLVALLVLSCSLSSWSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVAGSGYIYDGLCCHGQNFEGGATGVRFNYTIMPW
Ga0075446_1004839113300006190MarineMLLLMALWVCFFLPFSSSKAAEIEEVFIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPNDVPGTGYIHDGLCCDGQNFADGATGVRFNYTIMPWHTDLIDTGAGRFYTQGDTTYQKYMWENIAEYRYPDRENSFDLT
Ga0075446_1007403433300006190MarineLRNWLAAFLALSCSLSSWSDPEIIEHQISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGV
Ga0075447_1011776423300006191MarineLALCFLLSWSSKAAEIKEHIISDDGWVEIPLDFTFPFYGNSYVTSFMFANGVVGFLDPLDVPGQGYIYDGLCCNGPDLTSFTGVRFNYTIM
Ga0075447_1014181823300006191MarineMVLWVSFFLLSSSSKAAEIEEVFIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVDGTGYIHDGLCCNGEDFISGAQGVRFHYTIMPWHTDLIDTGTGRFYTQGDSTYQKYMWENIAEYRYPDRENSFDLTIYPLGN
Ga0068470_106697423300006308MarineMALLVSFSSLFWSAKAEAPIIEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVAGSGYVYDGLCCSGQDFSSGATGVRFHYTIMPWHTDLIDTGAGRFYTQGDSTFQKYMWENLAEYYDVGTENSFDLTIFPLGNIEIN
Ga0068471_133947113300006310MarineLPCKADAPIIEHTIADDGWVEVPLDFTFPFWGNSYTTSFMFSNGVVGFINPNNIPGTGIVNDGLCCSGIDFENATYSSMSSQGYGGVRFDFTIMPWHTDIIDTGPGHFYTQGDSTYQKYMWEA
Ga0068481_115069633300006339MarineMVLLVSFFLLCSSSRAEAPIVEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFNYTIMPWHTDLIDTGAGRFYTQGDSTYQKYMWENLAEYYNAATSNTFDLTIFPLG
Ga0075448_1018406013300006352MarineMVLWVSFFLLSSPSKADAPIIEHQIADDSWVEVPLDFTFPFYGNSYVTSFMFANGVVGFLEPDPQDWGLCCNGENLNTYTGPKFNYT
Ga0098033_105503213300006736MarineMALLVSFSSLFWSAKAEAPIVEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFHYTIMPWHTDLIDTGAGRFYTQGDSTFQKYMWENLAEYYDAGTENSFDLTIFPLGNIEINY
Ga0098037_110016313300006737MarineVCCFSLSSLSNPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIM
Ga0098035_123631023300006738MarineMALLVSFSSLFWSAKAEAPIVEHQIGDDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFNYTIMPWHTDLI
Ga0098048_100645113300006752MarineMVFLGLSFLPSSPTKADAPIIEHTISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVAGSGYIYDGLCCNGQNFEGGATGVRFNYTIMPFHTDLIDTGIGKFYTQGDSTYQKYM*
Ga0098048_113799423300006752MarineVAFLVLSFSLSSLSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGSGYIHDGLCCSGQDFANGGSGVRFNYTIMPWHTDLIYTGIGRFYTQGYSTFQKYMWEDLSEYYLPNTRNSFDLTIYPMGN
Ga0098048_117744323300006752MarineLKSWLVALLVLSCSLSSWSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQD
Ga0098039_123348423300006753MarineMALLALFFLLCSQPKADAPIIEHTIADDGWVEVPLDFTFPFWGNSYTTSFMFSNGVVGFISPNDIPGTGIVNDGLCCSGIDFENATYSSMSSQGYGGVRFDFTIMPWHTDLIDTGPGHFYTQGDSTYQKYMWEAVDEYYQTSRENTFDL
Ga0098039_124464413300006753MarineMALLVSFSSLFWSAKAEAPIVEHQIGDDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFHYTIMPWHTDLIDTGAGRFYTQGDSTFQKYMWENLAEYY
Ga0098044_117870723300006754MarineLRSLCLVFLALFFSLFSLPNKADAPIIEHTIVDDGWVEVPLDFIFPFWGNTYTTSFMFANGVIGFISPNDIPGSGYIYDGLCCNGQDFSSGATGVRFNFTIMPFHTDLIDIGAGHFYTQGDETFQSYFWEGISEYRDSSHQNTFSTTIYP*
Ga0098054_109148133300006789MarineLALFFLLSSPCKADPELIEHNIVDDGWVEVPLDFIFPFWGNTYTTSFMFANGVIGFISPNDIPGSGYIYDGLCCNGQDFASGATGVRFNFTIMPFHTDLIDIGAGHFYTQGDE
Ga0098054_117061513300006789MarineLRSLCLVFLALFFSLFSLPNKADAPIIEHTIVDDGWVEVPLDFIFPFWGNTYTTSFMFANGVIGFISPNDIPGSGYIYDGLCCNGQDFSSGATGVRFNFTIMPFHTDLIDIGAGHFYTQGDE
Ga0098054_119146223300006789MarineMVFLGLSFLPSSPTKADAPIIEHTISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVAGSGYIYDGLCCNGQNFEGGATGVRFNYTIMPFHTDLIDTGIGKFYTQGDSTYQKYMWENLAEYYNRDT
Ga0098054_119728623300006789MarineLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGIGRFYTQGDE
Ga0098055_117859423300006793MarineLRSLCLVFLALFFSLFSLPNKADAPIIEHTIVDDGWVEVPLDFIFPFWGNTYTTSFMFANGVIGFISPNDIPGSGYIYDGLCCNGQDFASGATGVRFNFTIMPFHTDLID
Ga0098055_120502113300006793MarineMVFLLSFFLLCSQPRAEAPIVEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFNYTIMPWHTDLIDTGAGRFYTQGDST
Ga0098055_122076513300006793MarineVAFLVLSFSLSSLSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGSGYIHDGLCCSGQDFANGGSGVRFNYTIMPWHTDLIDTGIGRFYTQGDSTFQKYMWEDL
Ga0098055_122926313300006793MarineLALFFLLSSPCKADPELIEHNIVDDGWVEVPLDFIFPFWGNTYTTSFMFANGVIGFISPNDIPGSGYIYDGLCCNGQDFASGATGVRFNFTIMPFHTDLID
Ga0070750_1028442423300006916AqueousLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNMYVTSFMFSNGVVGFLEPNPQDWGLCCDGQDLNNFTGSKFNYTIMPWHTDLIDTGIGRFYTQ
Ga0070750_1040121013300006916AqueousVCCFSLSSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNMYVTSFMFSNGVVGFLEPNPQNWGLCCDGQDLNNFTGSKFNYTIMPWHTDLIDTGIGRFYTQ
Ga0070748_107273533300006920AqueousVAFLALSFSLFSWSDPEIVEHQIADDGWVEVPLDFTFPFYGNMYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFT
Ga0070748_109280433300006920AqueousLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQD
Ga0070748_111274913300006920AqueousVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRF
Ga0098060_118339223300006921MarineLKSWLVALLVLSCSLSSWSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIHDGLCCHGQNFEGGATGVRFN
Ga0098060_119337823300006921MarineMVFLGLSFLPFSPTKADAEIIEHQISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGSGYIHDGLCCNGQDFSSGATGVRFNYTIMPWHTDLID
Ga0098060_122009823300006921MarineVALLALSFSLFSFSDPEIVEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIHDGLCCHGQDFANGASGVRFNYTIMPWHTDLIDTGIGKFYTQGDSTFQKYMWENLS
Ga0098045_104192913300006922MarineLRSLCLVFLALFFSLFSLPNKADAPIIEHTIVDDGWVEVPLDFIFPFWGNTYTTSFMFANGVIGFISPNDIPGSGYIYDGLCCNGQDFASGATGVRFNFTIMPFHTDLIDIGAGHFYTQGDENFQSYFWEGISEYRDSSHQNTFSTTIYPLGN
Ga0098053_104839323300006923MarineMALLVSFSSLFWSAKADAPIIEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFNYTIMPWHTDLIDTGAGRFYTQGDSTFQKYMWENLAEYYDVG
Ga0098053_112368923300006923MarineVALLALSFSLFSWSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIHDGLCCHGQNFEGGASGVRFNYTIMPWHTDLIDTG
Ga0098051_104369333300006924MarineLRSLCLVFLALFFSLFSLPNKADAPIIEHTIVDDGWVEVPLDFIFPFWGNTYTTSFMFANGVIGFISPNDIPGSGYVYDGLCCNGQDFSSGATGVRFNF
Ga0098050_106968813300006925MarineLKSWLVALLVLSCSLSSWSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGSGYIYDGLCCSGQDFANGGSGVRFNYTIMPWHTDLIDTGIGRFYTQGDSTFQKYMW
Ga0098050_110542023300006925MarineLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGIGRFYTQGDETF
Ga0098050_115364813300006925MarineVALLVLCSSLSSLSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVAGSGYIYDGLCCHGQNFEGGA
Ga0098041_101963713300006928MarineMVFLGLSFLPSSPTKADAPIIEHTISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVAGSGYIYDGLCCNGQNFEGGATGVRFNYTIMPFHTDLIDTGIGKFYTQGDSTYQKYMWENLAEYYNRD
Ga0098036_102863213300006929MarineMALLVLFFSLCSSSKADAPIVEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFNYTIMPWHTDLIDTGIGKFYTQGDSTFQKYMWENLSEYYIPNSRNTFDLTIYPMGNIA
Ga0098036_110391323300006929MarineMVFLVSFFLLCSQSKAEAPVVEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFNYTIMPWHTDLIDTGAGRFYTQGDSTYQKYMWENLAEYYNAATSNTFDLTIFPLGNIEINFEQLQINNH
Ga0098036_118243513300006929MarineVALLALSFSLFSWGDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGSGYIHDGLCCSGQDFANGASGVRFNYTIMPWHTDLIDTGIGRFYTQGDSTFQKYMWEDLSEYY
Ga0098046_105617223300006990MarineLKSWLVALLVLSCSLSSLSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLTVDGSGYIHDGLCCSGQDFANGATGVRFHYTIMPWHTDLIDTGVGRFYTQGDETFQK
Ga0098046_113961323300006990MarineVLFFSLSSLSDAPIIEHQISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGSGYIHDGLCCNGQDFSSGATGVRFNYTIMPWHTDLIDTGAGRFYTQGDSTYQKYMWENLAEYYDRNSENSFDLT
Ga0098052_123085113300008050MarineLALSFSLFSFSDPEIVEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVAGSGYIYDGLCCSGQDFANGASGVRFNYTIMPWHTDLIDTGIGKFYTQGDSTFQKYMWEN
Ga0098052_126092823300008050MarineLVLCFSLSSLSDPEIKEVQIGDDGWQEVKLDFSFPFYGNSYVTSFMFSNGVVGFLDPLDVAGSGYIYDGLCCHGQNFANGASGVRFNYTIMPWHTDLIDTGVGKFYTQGDSTFQK
Ga0114916_106524023300008221Deep OceanLLSSSSKAAEIEEVFIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVDGTGYIHDGLCCNGEDFISGAQGVRFHYTIMPWHTDLIDTGTGRFYTQGDSTYQKYMWENIAE
Ga0105349_1011863913300008253Methane Seep MesocosmLFFSLYSWADPEVIEHQIADDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLTVDGTGYVYDGLCCDGQDFSSGATGVRFHYTIM
Ga0102815_1056643013300009080EstuarineLFFSLYSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQNLSSFTGVRFNYTIMPWNTDLIDIGV
Ga0114994_1043646513300009420MarineLLSSLSRADAPLVEVEINDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPNDVPGSGYVYDGLCCDGPDLTSFTGVRFNYTIMPWSTDLIDT
Ga0115000_1051610523300009705MarineLLSSLSRADAPVVEVEIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLTVDGTGYIHDGLCCNGQDFNNGATGVRFHYTIMPWHTDLIDAGAGKFYTQGDDTYQKYMWENIVEYYDTSKENSFDLTIFPLGNIE
Ga0115001_1067454713300009785MarineMALLVFFFLPFSSSKAADVEEVFIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPNDVPGTGYIYDGLCCDGQDFSSGATGVRFNYTIMPWHTDLIDTGVGRFYTQGDTTYQKYMWENIAEYNDLSKENSFD
Ga0098049_107608333300010149MarineLALFFSLFSLPNKADAPIIEHTIVDDGWVEVPLDFIFPFWGNTYTTSFMFANGVIGFISPNDIPGSGYIYDGLCCNGQDFSSGATGVRFNFTIMPFHTDLIDIGAGHFYTQGDETFQSYFWEG
Ga0098059_124960923300010153MarineLPSSPTKADAPIIEHTISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVAGSGYIYDGLCCNGQNFEGGATGVRFNYTIMPFHTDLIDTGIGKFYTQGDSTYQKYMWENLAEYY
Ga0181374_104034613300017702MarineMALLVSFLSLFWSAKAEAPIVEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYVYDGLCCSGQDFSSGATGVRFNYTIMPWHTDLIDTGAGRFYTQGDSTYQKYMWENLAEYYNAATSNTFD
Ga0181391_105023223300017713SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDETFQKYMWENLSEYY
Ga0181390_107865023300017719SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLASFTGVRFNYTIMPWNTDLIDTGVGKFYTQ
Ga0181383_102634843300017720SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDG
Ga0181388_110477123300017724SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQNL
Ga0181398_115366623300017725SeawaterVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFIFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIHDGLCCSGQDFASGATGVRFHYTIMPWNTDLIDTGVGKFYTQGDSTFQKYMWENL
Ga0181401_105874223300017727SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSLFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDSTFQKYMWENLSEYYDRNTSNTFD
Ga0181396_106695823300017729SeawaterVLSFSLSSLSDPEIVEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYVYDGLCCHGQNLSSFTGVRFNYTIMPWN
Ga0181396_106985223300017729SeawaterLRNWLAVLLALSCSLSSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLASFTGVRFNYT
Ga0181416_105584413300017731SeawaterVAFLALSFSLFSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRF
Ga0181416_114323023300017731SeawaterVALLVLCSSLSSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVAGSGYIYDGLCCSGQDFSSGA
Ga0181418_111829223300017740SeawaterVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYVHDGLCCSGQDFSSGATGVRFNYTIMPWHTDLIDTGIGKFYTQGDSTFQK
Ga0181402_103836443300017743SeawaterLRNWLAVLLALSCSLSSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDETFQKYMWENLSEYYD
Ga0181397_112800223300017744SeawaterVLSFSLSSLSDPEIVEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYVYDGLCCHGQDLSSFTGVRFNY
Ga0181392_115985713300017749SeawaterLKSWLVALLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGD
Ga0181392_116890523300017749SeawaterLKSWLVALLVLSCSLSSWSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLASFTGVRFNYTIMPWNTDLIDTGVGKFYTQG
Ga0187219_111584723300017751SeawaterLKSWLVALLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGIGKFYTQ
Ga0181407_118921113300017753SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGIGKFYTQGDETFQKYMWENLSEYYNRDTSNTFDLTIYP
Ga0181382_107092823300017756SeawaterVLSFSLSSLSDPEIVEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDETFQKYMWENLSEYYRSE
Ga0181382_115763723300017756SeawaterLRNWLAVFLALCFSQFSYSEPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLASFTGVRFNYTIMPWNTDLIDTGIGKFYTQGDETFQKYMWENLSEYYDRNTSNTFD
Ga0181414_104669933300017759SeawaterVLSFSLSSLSDPEIVEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDETFQK
Ga0181408_117783623300017760SeawaterVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIHDGLCCSGQDFASGATGVRFHY
Ga0181422_106317213300017762SeawaterLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTF
Ga0181385_105351913300017764SeawaterLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGIGKFYTQGDETFQKYMWENLSEYYNRDTSNTFDLTIY
Ga0181385_118204713300017764SeawaterVAFLALSFSLFSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLS
Ga0181406_116197713300017767SeawaterVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDSTF
Ga0187217_115961123300017770SeawaterLKSWLVALLVLSCSLSSWSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLASFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDETFQKYMWENLSEYYDRNTSN
Ga0181432_110285223300017775SeawaterLPCKADPPIIEHTIADDGWVEVPLDFTFPFWGNSYTTSFMFSNGVVGFINPNNIPGTGIVNDGLCCSGIDFENATYSSMSSQGYGGVRFDFTIMPWHTDLIDTGPGHFYTQGDSTYQKYMWEAVDEYYQTTRENTFDLTIYPLGNIH
Ga0181432_117314823300017775SeawaterLRNLLTVLLALFFSLYSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQNISSFT
Ga0181394_101426113300017776SeawaterLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLS
Ga0181394_106176733300017776SeawaterVAFLALSFSLFSWSDPEIVEHQIADDSWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDE
Ga0181394_112726923300017776SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLID
Ga0181380_102618753300017782SeawaterLKSWLVALLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQG
Ga0181380_132005023300017782SeawaterLKSWLVAFLVLSCSLSSWSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLASFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDETFQKYMWENLSEYYDRNT
Ga0181379_107014813300017783SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDSTFQKYIS
Ga0181424_1038515923300017786SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPW
Ga0181424_1041182323300017786SeawaterVAFLALSFSLFSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYVHDGLCCSGQDFSSGAAGVRFNYTIMPWHTDLIDTGIGKFYTQGDSTFQKYMWENLSEYYNRDTSNSTVTTSTDAKSTIRTNPPSAISPS
Ga0193965_103724123300019742Freshwater Microbial MatVCCFSLSSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNMYVTSFMFSNGVVGFLEPNPQDWGLCCNGQDLNNFTGSKFNYTIM
Ga0211680_1033526713300020389MarineMALLVCFFLPFSSSKADASIIEHQIADDSWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPNDVPGTGYIHDGLCCDGQNFAGGATGVRFNYTIMPWHTDLIDTGAGRFYTQGDTTYQKYMWENIAEYNTANTENSFDLTIYPLGNIAMNYTEM
Ga0211575_1032202013300020407MarineMALLVSFSSLFWSAKADAPIIEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYVYDGLCCSGQDFSSGATGVRFHYTIMPWHTDLIDTGAGRFYTQGDSTFQKYMWENLAEYYDVGTENSFDL
Ga0211576_1056121313300020438MarineVALLVLCSSLSSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTGV
Ga0206677_1036573423300021085SeawaterLRNWLAVLLALSCSLSSLSDPEIIEHQIADDSWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWHTDLIDTGAGRFYTQGDSTYQKYMWENLAEYYNAATSNTFDLTIFPLGNI
Ga0206679_1053406113300021089SeawaterLRNLLTVLLALFFSLYSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSS
Ga0206691_189781313300021342SeawaterVVLLALFFLLCSQPKADPEIIEHTIADDGWVEVPLDFTFPFWGNTYTTSFMFANGVVGFISPNDIPGTGIVNDGLCCSGIDFENATYSSMSSQGYGGVRFDFTIMPWHTDLIDTGPGHFYTQGDSTYQKYMWEAVDEYYQTARENTFDLTIYP
Ga0206689_1096958623300021359SeawaterVSSLKNSCLVFLALFFLLCLPCKADAPIIEHTIADDGWVEVPLDFTFPFWGNSYTTSFMFANGVVGFISPNNIPGTGIVNDGLCCSGIDFENASYSSMSSQGYGGVRFDFTIMPWHTDLIDTGPGHFYTQGDSTYQKYMWEAV
Ga0206689_1104503913300021359SeawaterLRNLLTVLLALFFSLYSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPIDVPGTGIVYDGLCCDGQNLSSFTGVRFNYTIMPW
Ga0213863_1021245523300021371SeawaterVAFLALSFSLFSWSDPEIVEHQIADDGWVEVPLDFTFPFYGNMYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGI
Ga0213861_1053609413300021378SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSLFTGVRFNYTIMPW
Ga0206685_1017328213300021442SeawaterLRNLLTVLLALFFSLYSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGVGRFYTQGDSTFQKYMWEDLSEYYLPNTRNTFDLTI
Ga0226832_1027414413300021791Hydrothermal Vent FluidsLCSSSKADAPVVEHQIGDDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFHYTIMPWHTDLIDTGAGRFYTQGDSTFQKYMWENLAEYYDTGTENSFDLTIFPLGNIEINYTELELASHDREEKG
Ga0222717_1068621423300021957Estuarine WaterVALLVLCSSLSSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYVYDGLCCHGQDLSSFTGVRF
Ga0222718_1005070853300021958Estuarine WaterVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNMYVTSFMFSNGVVGFLEPNPQDWGLCCDGQDLNNFTGSKFNYTIMPWHTDLIDTGIGRFYTQGDETYQK
Ga0222716_1061379823300021959Estuarine WaterVALLVLCSSLSSLSDPEIVEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYVYDGLCCHGQDLSSFTGVRFNYTIMP
Ga0212024_106539713300022065AqueousVCCFSLSSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNMYVTSFMFSNGVVGFLEPNPQDWGLCCDGQDLNNFTGSKFNYTIMPWHTDLIDTGIGRFYTQGDSTYQKYMWKDLSEYYDRNTSNT
Ga0196887_110941723300022178AqueousLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDSTFQKY
Ga0224513_1020176623300022220SedimentLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYVYDGLCCHGQDLSSFTGVRFNYTIMPWNTD
Ga0224509_1039295323300022306SedimentLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYT
Ga0224504_1045961013300022308SedimentLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDSTFQKYMWENLSEYYDRNTSNTFDLT
(restricted) Ga0233411_1022975923300023112SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSF
Ga0232114_13263823300023676SeawaterVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDSTFQKYMWENLSEY
Ga0228681_103469113300023683SeawaterLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDETFQKYMWENLSEYYN
(restricted) Ga0255040_1007395133300024059SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTG
Ga0228665_112713813300024235SeawaterVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIHDGLCCSGQDFASGA
(restricted) Ga0233444_1046845613300024264SeawaterLRNWLAVLLALSCSLSSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGIGRFYTQGDETFQKYMWEDLSEYY
Ga0209992_1021869623300024344Deep SubsurfaceLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDETFQKYMWENLSEYYDRNTSNSFDL
Ga0244775_1144089613300024346EstuarineLRNWLAVLLALSCSLSSLSDPEIIEHQIADDSWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVR
Ga0244776_1050352223300024348EstuarineLRNLLTVLLALFFSLCSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGVGRFYTQGDSTFQKYMWEDLSEYYLPNTRNTFDLT
Ga0228632_103098213300024420SeawaterVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGIGKFYTQGDETFQKYMWEN
(restricted) Ga0255046_1017170533300024519SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTI
(restricted) Ga0255047_1029305623300024520SeawaterMVFLVSFFLLCSQPRAEAPIVEHQIGDDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLNPLDVAGTGYVYDGLCCSGQDFSSGATGVRFNYTIMPWHTDLI
Ga0207907_12622413300025043MarineMVLLLSFSSLFWSAKAEAPIVEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYVYDGLCCSGQDFSSGATGVRFHYTIMPWHTDLIDTGAGR
Ga0207901_104619013300025045MarineMALLLSFFLLCSQPRAEAPIVELQIGDDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIYDGLCCSGQDFSSGATGVRFNYTIMPWHTDLIDTGAGRFYTQGDSTYQKYMWENLAE
Ga0207902_103333413300025046MarineVLFFLLCLPCKADPPIVEHTIADDGWVEVPLDFTFPFWGNSYVTSFMFANGVVGFLDPLDVPGSGYIYDGLCCSGQDFSSGATGVRFNFTIMPWHTDIIDTGPGHFYTQGDSTYQKYMWEAIDEYYQTSRENTF
Ga0208012_105799113300025066MarineLRNWLTVLLALFFSLCSWSDPEVIEHQIADDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQNLSSFTGVRFNYTIMPWNTDLIDIGVGRFYTQGDSTFQKYMWE
Ga0207887_106065423300025069MarineLKNSCLVFLALFFLLCSQPKADAPIVEHTIADDGWVEVPLDFTFPFWGNSYVTSFMFANGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFNFTIMPWHTDIIDTGPGHFYTQGD
Ga0208791_102388633300025083MarineLQILLTAFLGLCFSLSSLSEAPIIEHTITDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLTVPGSGYIHDGLCCHGQDFANGATGVRFNYTIMPFHTDLIDTGVGKFYTQGDETYQKYMWEGLAEYYNTNTSNTFDLTIFPLGNISI
Ga0208791_105678813300025083MarineVALLVLCFSLSSLSDPEIVEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVAGSGYIYDGLCCHGQNFANGASGVRFNYTIMPWHTDLIDTGVGKFYTQGDSTFQKYMWENL
Ga0208298_108316923300025084MarineVALLVLCSSLSSLSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVAGSGYIYDGLCCHGQNFEGGATGVRFNYTIMPWHTDLIDTGI
Ga0208298_109720323300025084MarineLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGIGRFYTQG
Ga0208792_103471323300025085MarineMVFLGLSFLPSSPTKADAPIIEHTISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVAGSGYIYDGLCCNGQNFEGGATGVRFNYTIMPFHTDLIDTGIGKFYTQGDSTYQKYMWENLAEYYNRDTSNTFD
Ga0208792_106429913300025085MarineLRSLCLVFLALFFSLFSLPNKADAPIIEHTIVDDGWVEVPLDFIFPFWGNTYTTSFMFANGVIGFISPNDIPGSGYIYDGLCCNGQDFASGATGVRFNFT
Ga0208434_105946523300025098MarineLRNWLVALLALSFSLFSWGDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGSGYIHDGLCCSGQDFANGASGVRFNYTIMPWHTDLIDTGIGRFYTQGDSTFQ
Ga0208434_107969823300025098MarineVALLVLCSSLSSLSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVAGSGYIYDGLCCHGQNFEGGATGVRFNYTIMPWHTDLIDTGIGKFYTQGDSTFQKYMWENLSE
Ga0208434_109864213300025098MarineVALLVSSFSLFSWADPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIHDGLCCSGQNFEGGASGVRFNYTIMPWHTDL
Ga0208669_100468113300025099MarineVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGIGKFYTQGDETFQKYMW
Ga0208669_105658113300025099MarineMVFLGLSFLPFSPTKADAEIIEHQISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGSGYIHDGLCCNGQDFSSGATGVRFNYTIMPWHTDLIDT
Ga0208669_109199513300025099MarineVCCFSLSSLSNPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFN
Ga0208793_101010813300025108MarineVAFLVLSCSLSSWSDPEIIEHQIADDSWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGIGKFYTQGDETFQKYMW
Ga0208793_108294123300025108MarineLKNWLVVLLALFFSLFSWADPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGSGYIYDGLCCSGQDFANGGSGVRFNYTIMPWHTDLIDIGVGRFYTQGDSTFQKYMWEDLSEYYQPNTRNTFDLTIYP
Ga0208793_111670613300025108MarineLRNWLVALLVSSFSLFSWADPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIHDGLCCSGQNFEGGASGVRFNYTIMPWHTDLIDTGIGRFYTQGDSTFQKYMWEDLS
Ga0208793_112914513300025108MarineVALLVSSFSLFSWADPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIHDGLCCSGQNFEGGATGVRFNYTIMPWHTDLIDTGVGRFYTQGDETFQK
Ga0208793_115249213300025108MarineVALLALSFSLFSFSDPEIVEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIHDGLCCHGQDFANGASGVRFNYTIMPWHTDLIDTGIGKFYTQGDSTFQK
Ga0208793_117211513300025108MarineLALFFLLSSPCKADPELIEHNIVDDGWVEVPLDFIFPFWGNTYTTSFMFANGVIGFISPNDIPGSGYVYDGLCCNGQDFASGATGVRFNFTIMPFHTDLI
Ga0208158_110654513300025110MarineVAFLVLSFSLSSLSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGSGYIHDGLCCSGQDFANGGSGVRFNYTIMPWHTDLIDTGVGRFYTQ
Ga0208919_1006237113300025128MarineVAFLVLSCSLSSWSDPEIIEHQIADDSWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMP
Ga0208919_104045813300025128MarineVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMP
Ga0208919_107173333300025128MarineVAFLVLSFSLSSLSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGSGYIHDGLCCSGQDFANGGSGVRFNYTIMPWHTDLIDTGIGRFYTQGDSTFQK
Ga0208919_108938813300025128MarineMALLVLFFSLCSSSKADAPIVEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFNYTIMPWHTDLIDTGAGRFYTQGDSTYQKYMWENLAEYYNAA
Ga0208919_117287113300025128MarineVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMP
Ga0208919_122459423300025128MarineMALLVSFSSLFWSAKADAPIIEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFNYTIMPWHTDLIDTGAGRFYTQGDSTYQKYMWENLAEYYNTNTS
Ga0208299_104866343300025133MarineLRNWLVALLALSFSLFSWGDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGSGYIHDGLCCHGQDFANGASGVRFNYTIMPWHTDLIDTGIGKFYTQG
Ga0209337_119486913300025168MarineLRNWLAAFLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGIGKFYTQ
Ga0208814_111446213300025276Deep OceanLKNLCRVLLALCFLLSSLSRADAPVIEVEIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLTVDGTGYIHDGLCCDGQDFSSGATGVRFHYTIMPWHTDLIDAGAGKFYTQGDDTYQKYMWENIVEYYDTSKEN
Ga0209041_108833913300025623MarineLRNLLTALLALFFSLYSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQNLSSFTGVRFNYTIMPWNTDLI
Ga0209194_114106313300025632Pelagic MarineVALWVCCFSLSSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNMYVTSFMFSNGVVGFLEPNPQDWGLCCNGQDLNNFTGSKFNYTIMPWHTDLIDTGIGRFYTQGDETYQKYMWKDLSEYYDRNTSNTFDLT
Ga0208134_100889243300025652AqueousVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFN
Ga0208134_104407813300025652AqueousVAFLALSFSLFSWSDPEIVEHQIADDGWVEVPLDFTFPFYGNMYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTG
Ga0208134_105768113300025652AqueousVAFLALSFSLFSWSDPEIVEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFN
Ga0209360_114379923300025665MarineLRNLLTVLLALFFSLCSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGIGRFYT
Ga0209043_102900943300025667MarineLRNLLTVLLALFFSLCSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQNLSSFTGVRFNYTIMPWNTDLIDTGVGRFYTQGDST
Ga0209657_115842223300025676MarineLRNLLTVLLALFFSLCSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGVGRFYTQGDSTFQKYM
Ga0208767_109594033300025769AqueousVAFLALSFSLFSWSDPEIVEHQIADDGWVEVPLDFTFPFYGNMYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFN
Ga0209362_108637333300025770MarineLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGIGRFY
Ga0209714_108704513300025822Pelagic MarineLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVDGTGYVHDGLCCSGQDFASGATGVRFHYTIMPWHTDLIDTGIGKFYTQGDETFQKYMWENLSEYYDRNTSNS
Ga0209308_1025875613300025869Pelagic MarineLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNMYVTSFMFSNGVVGFLEPNPQDWGLCCDGQDLNNFTGSKFNYTIMPWHTDLIDTGIGRFYTQG
Ga0209757_1015909723300025873MarineMALLVSFSSLFWSAKADAPIIEHQIGDDQWKEIPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVAGSGYIYDGLCCSGQDFSSGATGVRFHYTIMPWHTDLIDTGAGRFYTQG
Ga0208644_129148013300025889AqueousLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNMYVTSFMFSNGVVGFLEPNPQDWGLCCDGQDLNNFTGSKFNYTIMPWHTDLIDTGIGRFYTQGDETYQKYMWKDLSEYYDRN
Ga0209630_1040415013300025892Pelagic MarineLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVDGTGYVHDGLCCSGQDFASGATGVRFHYTIMPWHTDLIDTGIGKFYTQGDETFQKYMWENLSEYYDRNTSNSFDLTIYP
Ga0208560_100279433300026115Marine OceanicMALLVLFFSLCSSSKADAPIVEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFNYTIMPWHTDLIDT
Ga0208127_106923713300026201MarineVAFLALSFSLFSWSDPEIVEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIHDGLCCSGQDFSSGATGVRFNYTIMPWHTDLIDTGIGRFYTQGDETFQKYMWENLSEYYD
Ga0208131_110129523300026213MarineLLCSQPKADAPIIEHTIVDDGWVEVPLDFTFPYWGNTYTTSFMFANGVVGFISPNDIPGTGIVNDGLCCQGYDLENVAYSDMNYGGSYGGVRFDFTIMPWHTDLIDTGPGHFYTQGDSTYQKYMWEAVDEYYQTARENTFDLTIYPLGNI
Ga0247581_101872833300026420SeawaterLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQ
Ga0247594_105214823300026448SeawaterLSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGIGKFYT
Ga0247578_104102113300026458SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTG
Ga0247600_106911123300026461SeawaterVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLID
Ga0247588_108159413300026465SeawaterLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDL
Ga0228604_103563823300026506SeawaterVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFY
Ga0247590_115452923300026513SeawaterVAFLALSFSLFSWSDPEIVEHQIVDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLASFTGVRFNYTIMPWNTDLIDT
Ga0228607_113825423300026517SeawaterVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDESFQKYMWENLSEYYNMN
Ga0208678_110310823300027233EstuarineLRNLLTVLLALFFSLCSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGVGRFYTQGDSTFQKYMWEDLSEYYLPNTRNTFDLTIYPMG
Ga0208950_103580243300027413MarineLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYVYDGLCCHGQDLSSF
Ga0209384_105715633300027522MarineLRNWLAAFLALSCSLSSWSDPEIIEYQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGVRFNYTIMPWHT
Ga0208964_112026813300027572MarineLRNLLTVLLALFFSLYSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQNLSSFTGVRFNYTI
Ga0209432_122330213300027630MarineMVFLVSFFLLFSQPRAEAPIVEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYVYDGLCCSGQDFSSGATGVRFHYTIMPWHTDLIDTGAGRFYTQGDSTFQKYMWENLAEYYDPGT
Ga0209482_106603713300027668MarineMALWVFFFSLSSSSKAAEIEEVFIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVDGTGYIHDGLCCNGEDFINGAQGVRFHYTIMPWHTDLIDTGTGRFYTQGDSTYQKYMWENIAEY
Ga0209482_116902713300027668MarineLALCFLLSWSSKAAEIKEHIISDDGWVEIPLDFTFPFYGNSYVTSFMFANGVVGFLDPLDVPGQGYIYDGLCCNGPDLTSFTGVRFNYTIMPWSTDLIDNGLGQFF
Ga0209383_111467913300027672MarineLRNWLAAFLALSCSLSSWSDPEIIEYQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGVRFNYTIMPWHTDLIDTGLGRFYTQGD
Ga0209071_106401413300027686MarineMVLWVSFFLLSSSSKAAEIEEVFIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVDGTGYIHDGLCCNGEDFISGAQGVRFHYTIMPWHTDLIDTGTGRFYTQGDSTYQKYMWENIAEYRYPDRENSFDLTIYPLGNIEMNYTEMAINNHAVTVAIV
Ga0209816_106805053300027704MarineLALCFLLSWSSKAAEIKEHIISDDGWVEIPLDFTFPFYGNSYVTSFMFANGVVGFLDPLDVPGQGYIYDGLCCDGPDLTSFTGVRFNYTIMPWSTDLIDNGLGQFFTQGDSTYQKYM
Ga0209816_123475713300027704MarineLRNWLAAFLALSCSLSSWSDPEIIEHQISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGVRFNYTIMPWHTDLIDTGLGR
Ga0208305_1028467013300027753EstuarineLRNWLAVLLALSCSLSSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLASFTGVRFNY
Ga0209709_1022473313300027779MarineLRNLLTGFLVLFFSLSSLSDAPIVEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPNDVPGTGYIYDGLCCDGQDFSSGATGVRFNYTIMPWHTDLIDTGAGRFYTQG
(restricted) Ga0255052_1019708613300027865SeawaterLRNWLTVLLALFFSLCSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVAGSGIVYDGLCCDGQNLSSFTGVRFNYTIMPWNTDLIDIGVGRFYTQGDSTFQKYMWEDLSEYYLPNSRNTFDL
(restricted) Ga0255055_1061968523300027881SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGVGRFYTQGDSTFQKYMWEDLSEYYLP
Ga0209404_1110852413300027906MarineLKSWLVALLVLSCSLSSWSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYIHDGLCCSGQNFEGGASGVRFNYT
Ga0247586_104098313300028102SeawaterVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDETFQKYMWEN
Ga0247561_10541813300028119SeawaterVALLVLCSSLSSLSDPEIIEHQIADDSWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLHVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMP
Ga0256411_128399813300028134SeawaterVALLVLCSSLSSLSDPEIIDHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGV
Ga0228608_120568523300028136SeawaterVAFLALSFSLFSWSYPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFTGVRFNYTIMPWNTDLIDTG
Ga0257114_121517023300028196MarineLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDSTFQKYMWE
Ga0257116_110760713300028277MarineLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQD
Ga0247601_105466713300028330SeawaterLKSWLVAFLVLSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGI
Ga0247566_106758623300028335SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLID
Ga0228643_104413313300028396SeawaterVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVR
Ga0257113_117335823300028488MarineVLFFLLCSPSKADPPIVEHTIADDGWVEVPLDFTFPFWGNSYVTSFMFANGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFNFTIMPWHTDIIDTGPGHFYTQGDSTYQKYMWEAIDEYYQTSRENTFDLT
Ga0257112_1028465623300028489MarineVLFFLLCSSCKADPEIIEHTIADDGWVEVPLDFTFPFWGNSYITSFMFANGVVGFISPNDIPGTGIVNDGLCCSGIDFENASYSSMSNQGYGGVRFDFTIMPWHTDLIDTGPGHFYTQGDSTYQKYMWEGVDEYYQVTRENTFDLTIYPLGNIKMNYEEL
Ga0257111_111080023300028535MarineMVFLVSFFLLCSQSKAEAPVVEHQIGDDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLNPLDVAGTGYVYDGLCCSGQDFSSGATGVRFHYTIMPWHTDLIDTGAGRFYTQG
Ga0308021_1023591223300031141MarineLRNWLAAFLALSCSLSSWSDPEIIEHQISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGVRFNYTIMPWHTDLIDTGLGRFYTQGDSTYQKYMWENLAEYRYPDRE
Ga0308023_106696813300031167MarineLRNWLAAFLALSCSLSSWSDPEIIEHQISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGVRFNYTIMPWHTDLIDTGLGRFYTQGDSTYQ
Ga0307488_1025707333300031519Sackhole BrineLRNWLAAFLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNMYVTSFMFSNGVVGFLDPNDVPGSGYVYDGLCCDGPDLTSFTGVRFNYTI
Ga0307489_1114335713300031569Sackhole BrineLRNWLAAFLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNMYVTSFMFSNGVVGFLDPNDVPGSGYIYDGLCCDGPDLTSFTGVRFNYTIMPWSTDLIDTGIGRFYTQGDSTYQKYMWKDLS
Ga0307999_100146113300031608MarineLALSCSLSSWSDPEIIEHQITDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGVRFNYTIMPWHTDLIDTGLGRFYTQGDS
Ga0307999_101498943300031608MarineLRNWLAALLALSCSLSSWSDPEIIEHQITDDSWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGVRFNYTIMPWHTDLIDTGLG
Ga0307999_105655623300031608MarineMLLLMALWVFFFLPFSSSKAAEIEEVFISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPNDVPGTGYIHDGLCCDGQNFIGGATGVRFNYTIMPWHTDLIDTGAGRFYTQGDSTYQKYMWENIAEYRYPDRENSFDLT
Ga0307985_1000715253300031629MarineLRNWLAAFLALSCSLSSWSDPEIIEHQISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGVRFNYTIMPWHTDLIDTGLGRFYTQGDSTYQKYMWENLAEYRYPDRENSFDLTIYP
Ga0307985_1007322813300031629MarineLALCFLLSWSSKAAEIKEHIISDDGWVEIPLDFTFPFYGNSYVTSFMFANGVVGFLDPLDVPGQGYIYDGLCCDGPDLTSFTGVRFNYTIMPWSTDLIDNGLGQFF
Ga0307985_1013353513300031629MarineLRNWLAVFLALSCSLSSWSDPEIIEYQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGVRFN
Ga0308001_1030048913300031644MarineMVLWVSFFLLSSSSKAAEIEEVFIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVDGTGYIHDGLCCNGEDFISGAQGVRFHYTIMPWHTDLIDTGTGRFYTQGDSTYQKYMWENIAEYRYPDRENSFDLTIYPLGNIE
Ga0307984_100393013300031658MarineLRNWLAALLALSCSLSSWSDPEIIEHQITDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGVRFNYTIMPWHTDLIDTGLGRFYTQGDS
Ga0307984_107360823300031658MarineMLLLMALWVCFFLPFSSSKAAEIEEVFIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPNDVPGTGYIHDGLCCDGQNFAGGATGVRFNYTIMPWHTDLIDTGVGRFYTQGDSTYQKYMWENIAEYRYPDRENSFDLTIYPL
Ga0307984_123065723300031658MarineLRNWLAALLALFCSLSSWSEPEIIEHQIADDSWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLTVDGTGYVYDGLCCDGQDFSSGATGVRFHYTIMPWHTDLIDTGIGRFYTQGNSTYQKYMWKD
Ga0307994_105825533300031660MarineLRNWLAAFLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPNDVPGSGYVYDGLCCDGPDLTSFTGVRFNYTI
Ga0308006_1010524323300031683MarineLALCFLLSWSSKAAEIKEHIISDDGWVEIPLDFTFPFYGNSYVTSFMFANGVVGFLDPLDVPGQGYIYDGLCCDGPDLTSFTGVRFN
Ga0308006_1022957323300031683MarineMVLWVSFFLLSSSSKAAEIEEVFIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVDGTGYIHDGLCCNGEDFISGAQGVRFHYTIMPWHTDLIDTGTGRFYTQGDSTYQKYMWENIAEYRYPDRENSFDLTIYPLGNIEMNYTEMAI
Ga0308008_117155913300031687MarineMLLLMALWVFFFLPFSSSKAAEIEEVFIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPNDVPGTGYIHDGLCCDGQNFAGGATGVRFNYTIMPWHTDLIDTGVGRFYTQGDSTYQKYMWENIAEYRYPDRENSFDLTIYPLGNIAMNYTEMAINNHSVTV
Ga0308011_1000377983300031688MarineLRNWLAALLALSCSLSSWSDPEIIEHQITDDSWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGVRFNYTIMPWHTDLIDTGLGRFYTQGDS
Ga0308011_1003462813300031688MarineMVLWVSFFLLSSSSKAAEIEEVFIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVDGTGYIHDGLCCNGEDFISGAQGVRFHYTIMPWHTDLIDTGTGRFYTQGDSTYQKYMWENIAEYRYPDRENSFDLTIYPLGNIAMNYTEMAINNH
Ga0308017_103619613300031689MarineMALWVFFFSLSSSSKAAEIEEVFIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLNVDGTGYIHDGLCCNGEDFINGAQGVRFHYTIMPWHTDLIDTGTGRFYTQGDSTYQKYMWEKI
Ga0308002_101917913300031703MarineLRNWLAALLALSCSLSSWSDPEIIEHQITDDSWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGVRFNYTIM
Ga0308002_103746913300031703MarineLRNWLAAFLALSCSLSSWSDPEIIEHQITDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFT
Ga0308002_108144213300031703MarineMALWVFFFLPFSSSKAAEIEEVFISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPNDVPGTGYIHDGLCCDGQNFAGGATGVRFNYTIMPWHTDLIDTGVGRFYTQGDSTYQKYMWENIAEYRYPDRENSFDLTIYPLGNIEMNYTEMAINNHS
Ga0308003_115911213300031705MarineMVLWVSFFLLSSSSKAAEIEEVFIGDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPNDVPGTGYIHDGLCCDGQNFNGGATGVRFNYTIMPWHTDLIDTGAGRFYTQGDSTYQKYMWEN
Ga0308013_1026976323300031721MarineLRNWLAAFLALSCSLSSWSDPEIIEHQISDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLTVDGTGYIHDGLCCNGEDFTNGATGVRFNYTIMPWHTDLIDTGLGRFYTQGDSTYQKYMWENIAEYRYPDRENSFDLTI
Ga0315328_1006249813300031757SeawaterLRNLLTVLLALFFSLYSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPIDVPGTGIVYDGLCCDGQNLSSFTGVRFNYTIMPWN
Ga0315322_1070466323300031766SeawaterLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYVHDGLCCSGQDFSSGAAGVRFNYTIMPWHTDLIDTGIGKFYTQGDSTFQKYMWENLSEYYNRDTSNTFDLTIYPMGN
Ga0315326_1026968813300031775SeawaterLRNLLTVLLALFFSLYSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCHGQDLSSFTGVRFNYTIMPWNTDLIDTGVGKFYTQGDET
Ga0315318_1052316413300031886SeawaterMVLLVSFFLLCSSCKADAPIIEHTIADDGWVEVPLDFTFPFWGNSYTTSFMFANGVVGFISPNDIPGTGIVNDGLCCSGIDFENASYSSMSSQGYGGVRFDFTIMPWHTDLIDTGPGHFYTQGDSTYQKYMWEAVDE
Ga0315318_1071368723300031886SeawaterVLFFLLCSPSKADPEIIEHTIADDGWVEVPLDFTFPFWGNSYTTSFMFSNGVVGFISPNDIPGTGIVNDGLCCSGIDFENATYSSMSSQGYGGVRFDFTIMPWHTDLIDTGPGHFYTQGDST
Ga0315318_1077552023300031886SeawaterLRNWLTVLLALFFSLCSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCDGQNLSSFTGVRFNYTIMPWNTDLIDIGVGRFYTQGDSTFQKYMWEDLS
Ga0315316_1083112323300032011SeawaterLKSWLVALLVLSCSLSSWSDPEIIEHQIVDDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLNPLDVPGTGYIHDGLCCSGQDFANGASGVRFNYTIMPWHTDLIDTGIGKFYTQGDSTFQKYM
Ga0315324_1037252823300032019SeawaterVVLLALFFLLCSQPKADPEIIEHTIADDGWVEVPLDFTFPFWGNTYTTSFMFANGVVGFISPNDIPGTGIVNDGLCCSGIDFENATYSSMSSQGYGGVRFDFTIMPWHTDLIDTGPGHFYTQG
Ga0315329_1021790313300032048SeawaterLLCSQPKADAPIIEHTIADDGWVEVPLDFTFPFWGNTYTTSFMFANGVVGFISPNDIPGTGIVNDGLCCQGYDLDNVAYSDMNYGGSYGGVRFDFTIMPWHTDLIDTGPGHFYTQGDSTY
Ga0315315_1161537123300032073SeawaterVAFLALSFSLFSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGIVYDGLCCQGQDLSSFT
Ga0315315_1191098613300032073SeawaterVALLVLCSSLSSLSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYVHDGLCCSGQDFSSGATGVRFNYTIMPWHTDLIDTGIGKFYTQGDSTFQKYMWENLSEYY
Ga0315321_1052899213300032088SeawaterLRNWLTVLLALFFSLCSWADPEVIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPIDVPGTGIVYDGLCCDGQNLSSFTGVRFNYTIMPWNTDLIDIGVGRFYTQGDSTFQKYMWEDLSEYYLPN
Ga0310345_1236384513300032278SeawaterMALLVSFFLLYSSSKADAPVVEHQIGDDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYVYDGLCCSGQDFSSGATGVRFHYTIMPWHTDLIDT
Ga0315334_1040688013300032360SeawaterMVFLVSFFLLCSQSKAEAPVVEHQIADDQWIEVPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYVYDGLCCDGQNFTGGATGVRFHYTIMPWHTDLIDTGAGRFY
Ga0316204_1057148723300032373Microbial MatLRNWLAVLLALSCSLSSWSDPEIIEHQIADDGWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYVYDGLCCDGQDLSSFTGVRFNYTIMPWNTDLI
Ga0310342_10080404933300032820SeawaterMALLVSFFSLYSSSKADAPIIEHQIGDDQWVEIPLDFTFPFYGNSYVTSFMFTNGVVGFLDPLDVPGSGYIHDGLCCSGQNFTGGATGVRFNYTIMPWHTDLIDTGLGRFYTQGDSTYQKYMWENLAEYYDAGTENSFDLTIF
Ga0310342_10280227513300032820SeawaterVLFFLLCSPSKADAPIIEHTIADDGWVEVPLDFTFPFWGNSYVTSFMFANGVVGFLDPLDVPGSGYIHDGLCCSGQDFSSGATGVRFNFTIMPWHTDLIDTGPGHFYTQGDSTYQKYM
Ga0314858_033301_2_3043300033742Sea-Ice BrineMRNWLAVLLALSCSLSSWSDPEIIEHQIADDSWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLTVDGTGYVYDGLCCDGQDFSSGATGVRFHYTIMPW
Ga0314858_048701_741_10223300033742Sea-Ice BrineLLSSLSRADAPIVEVEIADDSWVEVPLDFTFPFYGNSYVTSFMFSNGVVGFLEPNPQDWGLCCDGQDLEKFTGSKFNYTIMPWHTDLININGQF
Ga0348336_190313_236_5593300034375AqueousVAFLALSFSLFSWSDPEIVEHQIGDDGWIEVPLDFTFPFYGNSYVTSFMFSNGVVGFLDPLDVPGTGYVHDGLCCSGQDFSSGATGVRFNYTIMPWHTDLIDTGIGRF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.