Scaffold Ga0302135_10004931

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0302135_10004931

Scaffold Ga0302135_10004931

Overview

Basic Information
Taxon OID	3300031625 Open in IMG/M
Scaffold ID	Ga0302135_10004931 Open in IMG/M
Source Dataset Name	Marine microbial communities from Western Arctic Ocean, Canada - CBN3_surface
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7778
Total Scaffold Genes	17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (23.53%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location Name	Canada: Western Arctic Ocean
Coordinates	Lat. (^o)	80.9595	Long. (^o)	-132.1842	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090879	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0302135_100049314	F090879	N/A	MEQLYTEPSTILEENMDFSLHKHHKERVEYHMKMLNYYLKEEYNDRLGN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.