| Basic Information | |
|---|---|
| Taxon OID | 3300031576 Open in IMG/M |
| Scaffold ID | Ga0247727_10134619 Open in IMG/M |
| Source Dataset Name | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2445 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Virginia | |||||||
| Coordinates | Lat. (o) | 38.1667 | Long. (o) | -79.633 | Alt. (m) | Depth (m) | 9 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F070240 | Metagenome | 123 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247727_101346191 | F070240 | N/A | AKMRLQILVGTTVVGCWKNGTMAQCLDGSLGQWISFKGKRSGVLTWPAQSLGVKLTFQAVVKADRQTRKLRAPVTVQPAP |
| ⦗Top⦘ |