Scaffold Ga0307378_11083061

Overview

Basic Information

• Taxon OID: 3300031566
• Scaffold ID: Ga0307378_11083061
• Source Dataset Name: Soil microbial communities from Risofladan, Vaasa, Finland - UN-1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 645
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalogenimonas (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location

• Location Name: Finland: Risofladan, Vaasa
• Coordinates
  • Lat. (^o): 63.0472
  • Long. (^o): 21.7116
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036104	Metagenome / Metatranscriptome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307378_110830613	F036104	AGGAGG	MGQDSFPLAIGIIIAAAILGATFIAGMVLLAVLAL