Scaffold Ga0265605_1003598

Overview

Basic Information

• Taxon OID: 3300031560
• Scaffold ID: Ga0265605_1003598
• Source Dataset Name: Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_60m (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2514
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Canada: Sakinaw lake, British Columbia
• Coordinates
  • Lat. (^o): 49.68
  • Long. (^o): -124.009
  • Depth (m): 60

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014684	Metagenome / Metatranscriptome	261	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265605_10035982	F014684	N/A	MIGYALSGAGAGLVLDELIHGPFTLTPTNHEFWGIVIFIAGAVCISKKPHGKD