NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0314827_115782

Scaffold Ga0314827_115782


Overview

Basic Information
Taxon OID3300031476 Open in IMG/M
Scaffold IDGa0314827_115782 Open in IMG/M
Source Dataset NameMetatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R6 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)600
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States

Source Dataset Sampling Location
Location NameUSA: Pennsylvania
CoordinatesLat. (o)40.7997Long. (o)-77.8629Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087976Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0314827_1157821F087976N/AARDAQLKSEADAFKYKRELARVKRAQADRLREERRKCAGKCDREFPILVGPKNVPAKETRSVVVIGDRAANRKRWSAVSTHKRMFWHPKGLKKTARHITKAGRRIAAAHAKTKRISEAPLVEKPLF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.