Scaffold Ga0272430_1006765

Overview

Basic Information

• Taxon OID: 3300031460
• Scaffold ID: Ga0272430_1006765
• Source Dataset Name: Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace nord
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 15926
• Total Scaffold Genes: 25
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (48.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Victoria Land
• Coordinates
  • Lat. (^o): -77.6
  • Long. (^o): 161.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050800	Metagenome	144	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0272430_10067651	F050800	N/A	ERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLGLVCKSLDCVENEQHFVLYCPAYSHIRSQHLDLLQHCCTIADFMILCEANACGGFLRESFACRKQILSV