NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F050800

Metagenome Family F050800

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050800
Family Type Metagenome
Number of Sequences 144
Average Sequence Length 135 residues
Representative Sequence FEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGFFRECFACRKQILSV
Number of Associated Samples 17
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 31.94 %
% of genes near scaffold ends (potentially truncated) 72.22 %
% of genes from short scaffolds (< 2000 bps) 50.69 %
Associated GOLD sequencing projects 17
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.222 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock
(100.000 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(100.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 55.80%    β-sheet: 0.72%    Coil/Unstructured: 43.48%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF00069Pkinase 2.78
PF00078RVT_1 2.08
PF12400STIMATE 1.39
PF08386Abhydrolase_4 1.39
PF104171-cysPrx_C 0.69
PF00920ILVD_EDD 0.69
PF04784DUF547 0.69
PF00439Bromodomain 0.69
PF00097zf-C3HC4 0.69
PF01066CDP-OH_P_transf 0.69
PF14311DUF4379 0.69
PF01765RRF 0.69
PF00514Arm 0.69
PF13668Ferritin_2 0.69
PF00650CRAL_TRIO 0.69
PF03372Exo_endo_phos 0.69
PF00128Alpha-amylase 0.69
PF03235DUF262 0.69
PF12796Ank_2 0.69
PF02389Cornifin 0.69
PF12159DUF3593 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 11.11
COG0129Dihydroxyacid dehydratase/phosphogluconate dehydrataseCarbohydrate transport and metabolism [G] 1.39
COG0233Ribosome recycling factorTranslation, ribosomal structure and biogenesis [J] 0.69
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 0.69
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 0.69
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.69
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.69
COG1479DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domainsDefense mechanisms [V] 0.69
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 0.69
COG3280Maltooligosyltrehalose synthaseCarbohydrate transport and metabolism [G] 0.69
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300030517|Ga0272420_1002173All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-219340Open in IMG/M
3300030517|Ga0272420_1011295All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-26327Open in IMG/M
3300030517|Ga0272420_1011686All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-26201Open in IMG/M
3300030517|Ga0272420_1013949All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-25534Open in IMG/M
3300030517|Ga0272420_1019671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-24392Open in IMG/M
3300030517|Ga0272420_1024892All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23721Open in IMG/M
3300030517|Ga0272420_1028242All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23374Open in IMG/M
3300030517|Ga0272420_1029024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23302Open in IMG/M
3300030517|Ga0272420_1029151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae3292Open in IMG/M
3300030517|Ga0272420_1032217All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23032Open in IMG/M
3300030517|Ga0272420_1033714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22920Open in IMG/M
3300030517|Ga0272420_1036687All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22722Open in IMG/M
3300030517|Ga0272420_1056628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21797Open in IMG/M
3300030517|Ga0272420_1057051All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21783Open in IMG/M
3300030517|Ga0272420_1077436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21261Open in IMG/M
3300030517|Ga0272420_1084287All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21136Open in IMG/M
3300030517|Ga0272420_1113565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2778Open in IMG/M
3300030517|Ga0272420_1116245All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2754Open in IMG/M
3300030517|Ga0272420_1152532All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2506Open in IMG/M
3300030523|Ga0272436_1014132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-26706Open in IMG/M
3300030523|Ga0272436_1014977All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-26365Open in IMG/M
3300030523|Ga0272436_1022384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-24398Open in IMG/M
3300030523|Ga0272436_1027264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23650Open in IMG/M
3300030523|Ga0272436_1028105All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23550Open in IMG/M
3300030523|Ga0272436_1052669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21921Open in IMG/M
3300030523|Ga0272436_1089262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21150Open in IMG/M
3300030523|Ga0272436_1206194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2502Open in IMG/M
3300031447|Ga0272435_1007844All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-27001Open in IMG/M
3300031447|Ga0272435_1012505All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-24900Open in IMG/M
3300031447|Ga0272435_1016559All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta3933Open in IMG/M
3300031447|Ga0272435_1021795All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23199Open in IMG/M
3300031447|Ga0272435_1027024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22703Open in IMG/M
3300031447|Ga0272435_1028233All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22607Open in IMG/M
3300031447|Ga0272435_1033959All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22260Open in IMG/M
3300031447|Ga0272435_1040286All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21964Open in IMG/M
3300031447|Ga0272435_1044121All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21821Open in IMG/M
3300031447|Ga0272435_1052712All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21559Open in IMG/M
3300031447|Ga0272435_1061027All Organisms → Viruses → Predicted Viral1369Open in IMG/M
3300031447|Ga0272435_1098610All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2868Open in IMG/M
3300031447|Ga0272435_1118435All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2717Open in IMG/M
3300031447|Ga0272435_1118779All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2715Open in IMG/M
3300031447|Ga0272435_1139923All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2597Open in IMG/M
3300031448|Ga0272438_1013270All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-27337Open in IMG/M
3300031448|Ga0272438_1044315All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23069Open in IMG/M
3300031448|Ga0272438_1052731All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22697Open in IMG/M
3300031448|Ga0272438_1070145All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22164Open in IMG/M
3300031448|Ga0272438_1105466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21553Open in IMG/M
3300031448|Ga0272438_1111021All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21487Open in IMG/M
3300031448|Ga0272438_1157807All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21093Open in IMG/M
3300031448|Ga0272438_1199712All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2878Open in IMG/M
3300031448|Ga0272438_1254830All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2688Open in IMG/M
3300031448|Ga0272438_1305419All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2567Open in IMG/M
3300031449|Ga0272429_1007732All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-212204Open in IMG/M
3300031449|Ga0272429_1010268All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae10360Open in IMG/M
3300031449|Ga0272429_1020267All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae6664Open in IMG/M
3300031449|Ga0272429_1028541All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-25176Open in IMG/M
3300031449|Ga0272429_1066314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22496Open in IMG/M
3300031449|Ga0272429_1067188All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22466Open in IMG/M
3300031449|Ga0272429_1176561All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon938Open in IMG/M
3300031450|Ga0272433_10145676All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21415Open in IMG/M
3300031450|Ga0272433_10246003All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2928Open in IMG/M
3300031450|Ga0272433_10421512All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2579Open in IMG/M
3300031451|Ga0272426_1030448All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22695Open in IMG/M
3300031451|Ga0272426_1078416All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21384Open in IMG/M
3300031451|Ga0272426_1084128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21315Open in IMG/M
3300031451|Ga0272426_1119849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2995Open in IMG/M
3300031451|Ga0272426_1123308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2971Open in IMG/M
3300031451|Ga0272426_1152892All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2801Open in IMG/M
3300031451|Ga0272426_1211526All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2578Open in IMG/M
3300031453|Ga0272425_1018668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-25137Open in IMG/M
3300031453|Ga0272425_1072497All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21744Open in IMG/M
3300031453|Ga0272425_1088382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21494Open in IMG/M
3300031453|Ga0272425_1192733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2815Open in IMG/M
3300031453|Ga0272425_1209435All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2763Open in IMG/M
3300031453|Ga0272425_1237175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2690Open in IMG/M
3300031454|Ga0272427_1111793All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2960Open in IMG/M
3300031460|Ga0272430_1001229All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-253824Open in IMG/M
3300031460|Ga0272430_1004275All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-223516Open in IMG/M
3300031460|Ga0272430_1006765All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-215926Open in IMG/M
3300031460|Ga0272430_1006834All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-215790Open in IMG/M
3300031460|Ga0272430_1012260All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-29480Open in IMG/M
3300031460|Ga0272430_1012990All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-29034Open in IMG/M
3300031460|Ga0272430_1013342All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-28825Open in IMG/M
3300031460|Ga0272430_1019614All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-26330Open in IMG/M
3300031460|Ga0272430_1079120All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21714Open in IMG/M
3300031460|Ga0272430_1141165All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2852Open in IMG/M
3300031460|Ga0272430_1151581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2772Open in IMG/M
3300031470|Ga0272432_1036909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23216Open in IMG/M
3300031470|Ga0272432_1065471All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22011Open in IMG/M
3300031470|Ga0272432_1091047All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21542Open in IMG/M
3300031470|Ga0272432_1102163All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21403Open in IMG/M
3300031470|Ga0272432_1124928All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21189Open in IMG/M
3300031470|Ga0272432_1136499All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21104Open in IMG/M
3300031470|Ga0272432_1151842All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21011Open in IMG/M
3300031470|Ga0272432_1181734All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2865Open in IMG/M
3300031470|Ga0272432_1218173All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2732Open in IMG/M
3300031470|Ga0272432_1274771All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2590Open in IMG/M
3300031471|Ga0272439_1015211All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-27824Open in IMG/M
3300031471|Ga0272439_1035093All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-24309Open in IMG/M
3300031471|Ga0272439_1035988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-24229Open in IMG/M
3300031471|Ga0272439_1046685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23477Open in IMG/M
3300031471|Ga0272439_1065256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22654Open in IMG/M
3300031471|Ga0272439_1083056All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22153Open in IMG/M
3300031471|Ga0272439_1119824All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21518Open in IMG/M
3300031471|Ga0272439_1152028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21193Open in IMG/M
3300031471|Ga0272439_1195652All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2920Open in IMG/M
3300031471|Ga0272439_1213382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2842Open in IMG/M
3300031471|Ga0272439_1294852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2611Open in IMG/M
3300031471|Ga0272439_1348719All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2519Open in IMG/M
3300031473|Ga0272434_1023515All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-25548Open in IMG/M
3300031473|Ga0272434_1040360All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23942Open in IMG/M
3300031473|Ga0272434_1045379All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23646Open in IMG/M
3300031473|Ga0272434_1078633All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22452Open in IMG/M
3300031473|Ga0272434_1091427All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22175Open in IMG/M
3300031473|Ga0272434_1094052All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22126Open in IMG/M
3300031473|Ga0272434_1107675All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21895Open in IMG/M
3300031473|Ga0272434_1117896All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21751Open in IMG/M
3300031473|Ga0272434_1119351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21732Open in IMG/M
3300031473|Ga0272434_1178356All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21188Open in IMG/M
3300031473|Ga0272434_1280555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2738Open in IMG/M
3300031520|Ga0272428_1304054All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2666Open in IMG/M
3300031909|Ga0272421_1005527All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-26405Open in IMG/M
3300031909|Ga0272421_1007733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-25262Open in IMG/M
3300031909|Ga0272421_1010895All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-24290Open in IMG/M
3300031909|Ga0272421_1012552All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23943Open in IMG/M
3300031909|Ga0272421_1015494All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23435Open in IMG/M
3300031909|Ga0272421_1026262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22388Open in IMG/M
3300031909|Ga0272421_1026351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22382Open in IMG/M
3300031909|Ga0272421_1032834All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22019Open in IMG/M
3300031909|Ga0272421_1042724All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21644Open in IMG/M
3300031909|Ga0272421_1044043All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21604Open in IMG/M
3300031909|Ga0272421_1045644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21558Open in IMG/M
3300031909|Ga0272421_1051647All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21405Open in IMG/M
3300031909|Ga0272421_1067256All Organisms → Viruses → Predicted Viral1123Open in IMG/M
3300031909|Ga0272421_1079957All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2963Open in IMG/M
3300031909|Ga0272421_1110909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2702Open in IMG/M
3300032162|Ga0272424_1001079All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-253323Open in IMG/M
3300032162|Ga0272424_1022087All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-26891Open in IMG/M
3300032162|Ga0272424_1128671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21256Open in IMG/M
3300033181|Ga0272431_10046941All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23528Open in IMG/M
3300033181|Ga0272431_10047777All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23484Open in IMG/M
3300033181|Ga0272431_10083292All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22314Open in IMG/M
3300033181|Ga0272431_10231939All Organisms → Viruses → Predicted Viral1007Open in IMG/M
3300033181|Ga0272431_10481502All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2516Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock100.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300030517Rock endolithic microbial communities from Victoria Land, Antarctica - Battleship Promontory nordEnvironmentalOpen in IMG/M
3300030523Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstoneEnvironmentalOpen in IMG/M
3300031447Rock endolithic microbial communities from Victoria Land, Antarctica - Ricker Hills nordEnvironmentalOpen in IMG/M
3300031448Rock endolithic microbial communities from Victoria Land, Antarctica - Knobhead nordEnvironmentalOpen in IMG/M
3300031449Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt sudEnvironmentalOpen in IMG/M
3300031450Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sudEnvironmentalOpen in IMG/M
3300031451Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak nordEnvironmentalOpen in IMG/M
3300031453Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte sudEnvironmentalOpen in IMG/M
3300031454Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak sudEnvironmentalOpen in IMG/M
3300031460Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace nordEnvironmentalOpen in IMG/M
3300031470Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley nordEnvironmentalOpen in IMG/M
3300031471Rock endolithic microbial communities from Victoria Land, Antarctica - Knobhead sudEnvironmentalOpen in IMG/M
3300031473Rock endolithic microbial communities from Victoria Land, Antarctica - Trio Nunatak nordEnvironmentalOpen in IMG/M
3300031520Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nordEnvironmentalOpen in IMG/M
3300031909Rock endolithic microbial communities from Victoria Land, Antarctica - Buttleship Promontory sudEnvironmentalOpen in IMG/M
3300032162Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte nordEnvironmentalOpen in IMG/M
3300033181Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace sudEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0272420_1002173273300030517RockMLYRTVQPEYKSAEYLSVVKCVSNRRLISRFRTGCHGLRGDTGRRADGVHLDRTDRLCLVCKLLDCVEDEQHYVFDRPAYCHIRSQHLDLLQHCCTMADFMFLCEPNACGGFLRECFACRKQILTV
Ga0272420_1011295103300030517RockHNFDIASVIERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAKYLSVVKCASNRRLISRFRTGCHGLRVDTGRYADAFHLDRTDRLCLVCKSLDYVEDEQHFVFDRPAYSHIRSQNLDILQDCCTIADFMTLCEPNACGAFLRECFACRKQILSV
Ga0272420_101168653300030517RockMLYRTMQPEYKSAEYLSVVKCASNRRLVSRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDYVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTVADFMTLCEPNACGGFLGECFACRKQILSV
Ga0272420_101394913300030517RockFLHGHLGQQQLFHNFDIASVIERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTAADFMILCEPNACGCFACRKSV
Ga0272420_101967113300030517RockMCDRIDTPDLASVIERAKHQHAFEYFADVQHSSLMLYRMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGFLRER
Ga0272420_102489243300030517RockMLYRTMQPEYKYAEYLSVVKCVSNRRLIRWFRTGWHGLCVDTGRQACADGVHLDRTDRLCLVCKSLDCVENEQHFVQICPAYSHIRSQHLDLLQHCCTIADFTFWCEPKRNACGDFLRECFACRKQIFESMNN
Ga0272420_102824233300030517RockIASVIERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSIVKCASNRRLSSRFRTRCHGLRVDTGRWADGVHLDRTDRLCPVCKSLDYVEDEQHFVFHCPAYSHIRSQHLDLLRHCCTIADFMTLCEPDACGGFLRECFACRKQILSV
Ga0272420_102902453300030517RockTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHDLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPDACGGFLRECFACRNQILSV
Ga0272420_102915113300030517RockMLYRTMQPEYKSAEYLSVVKCVSNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCRVCKSLDCAEDEQQFVFDCPAYSHIRSQHLDLLQLCCTIADFMSLCEANACSGFLRGCFACRKQILTV
Ga0272420_103221763300030517RockMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRLDTGRLADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMTLCEPNACGGCLRECFACRKQIVS
Ga0272420_103371413300030517RockMERAKHQHAFEYFADVQHNSLMLCRTMQPEYKSAVYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVRLDRTDRLCLVCKSLDYVEDEQHFVFDCPAYSHIGSQHLILLQHCCTIADFMTLCEPKACGGLLRECFACRKQILSV
Ga0272420_103668743300030517RockVLYRTMQPEHKYAEYLSVVKCVSNRRLISRFRTGCHGLPVDTGRWADGVHLDSTDRLCLVCKSLDCVKDEQHFTFDCPAYSHIRSQHLDLLQHCCTIADFMSLYEPNACGGFLRECFACRKQILTV
Ga0272420_105662843300030517RockMQPTRVQNHVCTLIIRWYFCAFEYFADAQHSSLILYRTMQPEYKSAEYLSVVKCASNRRLTSRFRTGCHGVRVDTGHWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCQRSHIRSQHLDLLQHCCTIADFMTLCEPNACGGFLTECFACRKQ
Ga0272420_105705113300030517RockMLYRTMQPEYKSAEYLSVVKCVSNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQQFVFDCPAYSHIRSQHLDLLQHCCTNADFMSLCEANTCSGFLREFFACRKQILTV
Ga0272420_107743613300030517RockERAKHQHAFEYFADIQHSSLMLYRTMQPEYKSAEYLSVVKCAPNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMFLCEPNACGGFLRECFAYRKQILSV
Ga0272420_108428723300030517RockMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLWVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNASGGFLRECFACRKQILS
Ga0272420_111356513300030517RockMLYRTMQPEYKSAEYLSVVKCASNRRLITRFRTGCHGLRVDTGRWAGGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDRLQHCCTIADFMILCEPNACGGFLRECFACRKQILSV
Ga0272420_111624513300030517RockMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGFL
Ga0272420_115253213300030517RockERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFTTGCHGLRVDTGRWADGVHLDRTDRLGLVCKSLDCVENEHHFVLYCPAYSHIRSQHLDLLQHCCTIADFMILCEANACGGFLRESFACRKQILSV
Ga0272436_101413213300030523RockHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLITRFRTGCHGLRVDTGRWAGGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDRLQHCCTIADFMILCEPNACGGFLRECFACRKQILSV
Ga0272436_101497753300030523RockMQPTRVQNHVCTLIIRWYFCAFEYFADAQHSSLILYRTMQPEYKSAEYLSVVKCASNRRLTSRFRTGCHGVRVDTGHWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCQRSHIRSQHLDLLQHCCTIADFMTLCEPNACGGFLTECFACRKQILSV
Ga0272436_102238413300030523RockHLGQQQLFHNFDIASVIERAKHQHAFEYSADVQHSSLMLYRTMQPEYKSAEYLSVVKRVSNRRLISRCRTGCHGLQVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILREPNACGGFLRECFACRKQILSV
Ga0272436_102726463300030523RockFLHGHLGQQQLFHNFDIASVMERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISSFRTGCHGLRGDTGRWADGVHLDRTDRLCLVCKSLHYVEDEQHFVVDCPAYSHIRSQHLDLLQHCCTIADFATLCEPNACGGSLRECFACRKQISSV
Ga0272436_102810533300030523RockMLYRTVQPEYKSAEYLSVVKCVSNRRLISRFRTGCHGLRGDTGRCADGVHLDRTDRLCLVCKLLDCVEDEQHYVFDRPAYCHIRSQHLDLLQHCCTMADFMFLCEPNACGGFLRECFACRKQILTV
Ga0272436_105266913300030523RockIASVERAKHQHAFEYFAVVQHSSLMLYRTMQPEYKYAEYLSVVKCVSNRRLIRWFRTGWHGLCVDTGRQACADGVHLDRTDRLCLVCKSLDCVENEQHFVQICPAYSHIRSQHLDLLQHCCTIADFTFWCEPKRNACGDFLRECFACRKQIFESMNN
Ga0272436_108926213300030523RockMLYRTMQPEYKSAEYLSVVKCVSNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQQFVFDCPAYSHIRSQHLDLLQHCCTNADFMSLCEANTCSGFLREFFACRKQ
Ga0272436_120619423300030523RockMQPEYKSAEYLSVVKCASNRRLISRFRTRCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHCVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACCGFLRECFACR
Ga0272435_1007844133300031447RockDIASVERAKHQHAFEYFAVVQHSSLMLYRTMQPEYKYAEYLSVVKCVSNRRLIRWFRTGWHGLCVDTGRQACADGVHLDRTDRLCLVCKSLDCVENEQHFVQICPAYSHIRSQHLDLLQHCCTIADFTFWCEPKRNACGDFLRECFACRKQIFESMNN
Ga0272435_101250553300031447RockMQPEYKSAVYLSVVKCASIRRLISRFKTGCHGLRVDTGRWADCDHLDRTDRLCLVCMSLDYVEDEQHFVFDCPACSHIRSQHLDLLQHCCTIADFMTLCEPNACGGFLRECFACRKQILS
Ga0272435_101655983300031447RockLRNHSSGWVTPEYQIACTAELLSNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKLLDCVEDEQHFVFDCPAYSHIRSQHLEVLQHCCTIADFMMFCEPNACGGFLRECFACRKQILSV
Ga0272435_102179523300031447RockMLYRTKQPEYKSAVYLSVVKYVSNRRLISRPRFRTGWHGLRVDTGRWADGVLVCKSLDCVEDEQHFIFYCPAYSHIRSQHLDLLQHCCTTADFMSLCEPNASGGFLRECFACRKQI
Ga0272435_102702413300031447RockLAGDFLHGHLGQQQLFHNFDIASVIERAKHQHAFEYFADIHSSLMLYRTMQPEYKSAEYLSVIKCASNRRLNSRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHICEMHQVTAFGPPAARCTIADFMILCEPNACGGFLRECFAYRKQILSV
Ga0272435_102823313300031447RockPEYKSAEYLSVVKCASNRRLISRFRTGCHDLRVDTGRWANGVHLDRTDRLCLVCKSLDCVEDEQHFVFYCPAYSHIRSQHLDLLQHCCTIADFMTLCEPNACGGFLRGCFARRKQILSL
Ga0272435_103395943300031447RockMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDYVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTVADFMTLCEPNACGGFLGECFACRKQILSV
Ga0272435_104028623300031447RockIASVIERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSIVKCASNRRLSSRFRTRCHGLRVDTGRWADGVHLDRTDRLCPVCKSLDYVEDEQHFVFHCPAYSHIRSQHLHLLRHCCTIADFMTLCEPDACGGFLRECFACRKQILSV
Ga0272435_104412123300031447RockMQPEYKSAEYLSVVKCASNRRLISRFRTRCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHCVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACCGFLRECFACRKQILS
Ga0272435_105271213300031447RockHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADSVHLDRTDRLCLLCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTVADFMILCEPNACGGCLRECFARRKQILSV
Ga0272435_106102733300031447RockMLYRTMQPEYKSAEYLSVVKCASNRRLIGRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTVADFMILCEPNA
Ga0272435_109861013300031447RockQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLVSRFRTGCHGPRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDKQHFVFDCPAYSHIRSQHLDLLQHCCTIAVFMILCEPNACGGFLRC
Ga0272435_111843513300031447RockYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRLDKGRWADGVHLDRTDRLCLVCKSVDYVEDEQHFVFDCPAYSHIRSQHLDLLQHYCTIADFMTLCEPNACGGFLRECFACRKQILSV
Ga0272435_111877913300031447RockAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLITRFRTGCHGLRVDTGRWAGGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDRLQHCCTIADFMILCEPNACGGFLRECFACRKQILSV
Ga0272435_113992323300031447RockMHLSTMQMFSTVLYRTMQPEYKSAEYLSVVKCASNIRLISRFRTGCHGLRVDTGRWADDVHLDRTDRLCLVCKSLDCVEDEQHFVLYCPAYSHIRSQHLDLLQHCCTIADFMILCEPNAYGGFLRECFACRKQILSV
Ga0272438_101327013300031448RockLAGDFLHGHLGQQQLFHNFDIASVIERAKHQHAFEYFADIHSSLMLYRTMQPEYKSAECLSVIKCASNRRLNSRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHICEMHQVTAFGPPAARCTIADFMILCEPNACGGFLRECFAYRKQILSV
Ga0272438_104431513300031448RockMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGFLRERFAYRKQILSVGSQLPPRTLNILID
Ga0272438_105273133300031448RockEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVRLDRTDRLCLVCKSLDYVEDEQHFVFDCPAYSHIGSQHLILLQHCCTIADFMTLCEPKACGGLLRECFACRKQILSV
Ga0272438_107014523300031448RockMLYRTKQPEYKSAVYLSVVKYVSNRRLISRPRFRTGWHGLRVDTGRWADGVLVCKSLDCVEDEQHFVFYCPAYSHIRSQHLDLLQHCCTIADFMSLCEPNASGGFLRECFACRKQILTV
Ga0272438_110546613300031448RockQPEYKSAEYLSVVKCASNRRLITRFRTGCHGLRVDTGRWAGGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDRLQHCCTIADFMILCEPNACGGFLRECFACRKQILSV
Ga0272438_111102113300031448RockRAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAKYLSVVKCASNRRLISRFRTGCHGLRVDTGRYADAFHLDRTDRLCLVCKSLDYVEDEQHFVFDRPAYSHIRSQNLDILQDCCTIADFMTLCEPNACGAFLRECFACRKQILSV
Ga0272438_115780713300031448RockMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDGVEDEQHFVFDCPAYSHIRSQHLDLLQHLCTIADFMILCEPNACGGFLRECFACRKQILSV
Ga0272438_119971213300031448RockMSYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLQVDTGRWADGVHLDRTDRLCLVCQSLDYVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMTLCEPN
Ga0272438_125483013300031448RockNFDIASVIERAKHQHAFEYFADVQHSSLMLYRTMQPEYKAAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLYYVEDEQHFDFDCPAYSHIKSQHLDLLQHCCTIADFM
Ga0272438_130541923300031448RockMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADSVHLDRTDRLCLVCKSLDYVEDEQHFVFDCLAYSHIRSQHLDLLQHCHTIADFMTLCEPNACGGFLRECFACRKQILS
Ga0272429_1007732213300031449RockFLHGHLGQQQLFHNFDIASVIERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFTTGCHGLRVDTGRWADGVHLDRTDRLGLVCKSLDCVENEQHFVLYCPAYSHIRSQHLDLLQHCCTIADFMILCEANACGGFLRESFACRKQILSV
Ga0272429_101026863300031449RockMQPEYKPAEYLSVVMFASNRRLISRFRTGCHGLRVDTGRWVDGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMTLCERNTCGGFLRECLACRKQILS
Ga0272429_102026793300031449RockMQPEYKPAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMTLCEPNTCGGFLRECFACRKQILS
Ga0272429_102854183300031449RockMERAKHQHAFEYFADVQHNSLMLCRTMQPEYKSAVYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVRLDRTDRLCLVCKSLDYVEDEQHFVFDCPAYSHIGSQHLILLQHCCTIADFMTFCEPKACGGLLRECFACRKQILSV
Ga0272429_106631413300031449RockSVVKCASNRRLISRFRTGCHGLRVDTGRWADSVHLDRTDRLCLLCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTVADFMILCEPNACGGCLRECFARRKQILSV
Ga0272429_106718813300031449RockKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSIVKCASNRRLSSRFRTRCHGLRVDTGRWADGVHLDRTDRLCPVCKSLDYVEDEQHFVFHCPAYSHIRSQHLDLLRHCCTIADFMTLCEPDACGGFLRECFACRKQILSV
Ga0272429_117656113300031449RockSLMLYRTMQPEYKPAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDKQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMTLCEPNTCGGFLRQILS
Ga0272433_1014567623300031450RockPEYKSAEYLSVVKCASNRRLISRFRTGCHGLWVDTGRWADGVHLGRTARLCLVCKSLDCVEDEQHFGFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGFLRE
Ga0272433_1024600313300031450RockMERAKHQHAFEYFADVQHNSLMLCRTMQPEYKSAVYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVRLDRTDRLCLVCKSLDYVEDEQHFVFDCPAYSHIGSQHLILLQHCCTIADFMT
Ga0272433_1042151213300031450RockSKRRLVSRFRTGCHGLRVDTGRWADGVHLVRTDRLCLVCKSLDCVEDEQHFIFDCPAYSYIRSQHLDLLQHCCTIADFMSLCEPNACGGFLRECFACRKQILTMNSLN
Ga0272426_103044853300031451RockKPAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDKTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMTLCEPNTCVGFLRECFACRKQILSV
Ga0272426_107841613300031451RockERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFTTGCHGLRVDTGRWADGVHLDRTDRLGLVCKSLDCVENEQHFVLYCPAYSHIRSQHLDLLQHCCTIADFMILCEANACGGFLRESFACRKQILSV
Ga0272426_108412813300031451RockSSLVSYRTMQPEYKYAEYLSVVKCVSKRRLVSRFRTGCHGLRVDTGRWADGVHLVRTDRLCLVCKSLDCVEDEQHFIFDCPAYSYIRSQHLDLLQHCCTIADFMSLCEPNACGFLRECFACRKQILTV
Ga0272426_111984913300031451RockLYHNFDIASVIERAKHQHALEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCVSNRRLISRFRTGCHGLRVDTGRWADSVHLDRTDRLCLVCKSLDFVEDEQQTVFDCPAYSHIRSQHMDLLQHCCTIAEFLSLCEPNACGDFLRECFACRKQRLTV
Ga0272426_112330813300031451RockEYKSAEYLSVVKCVSNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCRVCKSLDCAEDEQQFVFDCPAYSHIRSQHLDLLQLCCTIADFMSLCEANACSGFLRGCFACRKQILTV
Ga0272426_115289213300031451RockMLYRTMQPKYKYAEYLSVVKCASNRKLISRVRTGCHGLRVDTGRWADGVHLNRTDRLCLVCKSLDCVEDEQHFVFYCPAYSHIRSQYLDLLQHCCTIADFVTLCEQNACGAFLRECFACRKQVLSV
Ga0272426_121152613300031451RockMLYRTMQPEYKPAEYLSVVKCASNRRLISRLRTGCHGLRVDTGRWADGVHLDRTNRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLNLLQHSVTVVLLQT
Ga0272425_101866863300031453RockLSVVKCASNRRLIGRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTVADFMILCEPNACGGFLRECFACRKQILSV
Ga0272425_107249733300031453RockASVIERAKHQHAFEYFADIQHSSLVLYRTMQPEHKYAEYLSVVKCVSNRRLISRFRTGCHGLPVDTGRWADGVHLDSTDRLCLVCKSLDCVKDEQHFTFDCPAYSHIRSQHLDLLQHCCTIADFMSLYEPNACGGFLRECFACRKQILTV
Ga0272425_108838213300031453RockFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADSVHLDRTDRLCLVCKSLDYVEDEQHFVFDCLAYSHIRSQHLDLLQHCHTIADFMTLCEPNACGGFLRECFACRKQILSV
Ga0272425_119273313300031453RockKHQHAFEYFADIQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPPYSHIRSQHLDLLQHCCTIADFMILCEPNACGGFLKECFACRKQILSV
Ga0272425_120943523300031453RockQLFHNFDIASVIERAKHQHAFEYFADIQHSSLVSYRTLQPEYKYAEYLSVVKCVSNRRLISRFRTVCHGLRVDTGRWADGVHLVRTDRLCLVCKALDCVEDEQHFIFDCPAYSHIRSQHLDLLQHCCTIADFMSLCEPNACGGFLRECFACRKQILTV
Ga0272425_123717523300031453RockEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFTTGCHGLRVDTGRWADGVHLDRTDRLGLVCKSLDCVENEQHFVLYCPAYSHIRSQHLDLLQHCCTIADFMILCEANACGGFLRESFACRKQILSV
Ga0272427_111179313300031454RockMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADCMILC
Ga0272430_1001229173300031460RockMQLEYRPAEYLSVVKCASNRRLISRFRTGCHGLWVDTGRWADGVHLGRTDRVCLVCRSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMTLCEPNAFGGFLRECFACRKQILS
Ga0272430_1004275313300031460RockEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLWVDTGRWADGVHLGRTARLCLVCKSLDCVEDEQHFGFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGFLRE
Ga0272430_100676513300031460RockERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLGLVCKSLDCVENEQHFVLYCPAYSHIRSQHLDLLQHCCTIADFMILCEANACGGFLRESFACRKQILSV
Ga0272430_100683413300031460RockMLYRTMQPEYKYAEYLSVVKCVSNRRLIRWFRTGWHGLCVDTGRQACTDGVHLDRTDRLCLVCKSLDCVENEQHFVQICPAYSHIRSQHLDLLQHCCTIADFTFWCEPKRNACGDFLRECFACRKQIFESMNN
Ga0272430_101226093300031460RockMQPTRVQNHVCTLIIRWYFCAFEYFADAQHSSLILYRTMQPEYKSAEYLSVVKCASNRRLTSRFRTGCHGLRVDTGHWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCQRSHIRSQHLDLLQHCCTIADFMTLCEPNACGGFLTECFACRKQILSV
Ga0272430_101299013300031460RockSSGTRRACRQVTPVILGDFLHGHLGQRQLFHNFDTASVIERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLITRFRTGCHGLRVDTGRWAGGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDRLQHCCTIADFMILCEPNACGGFLRECFACRKQILSV
Ga0272430_101334213300031460RockSVIERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCQGVRVDTGRWADGVHLDRTDRLCRVCKSLDSVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGFLREFFACRK
Ga0272430_101961413300031460RockNFDIASVIERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAKYLSVVKCASNRRLISRFRTGCHGLRVDTGRYADAFHLDRTDRLCLVCKSLDYVEDEQHFVFDRPAYSHIRSQNLDILQDCCTIADFMTLCEPNACGAFLRECFACRKQILSV
Ga0272430_107912023300031460RockMVILGQQQLFHNFDIASVIERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLQVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGFLRECFACRNQILSV
Ga0272430_114116513300031460RockMLYRTMQPEYKSAEYLSVVKCASNRRLVSRFRTGCHGPRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDKQHFVFDCPAYSHIRSQHLDLLQHCCTIAVFMILCEPNACGGFLRC
Ga0272430_115158113300031460RockERAKHQHAFEYFADIQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADCMILCEPNACGGFLRMLCM
Ga0272432_103690943300031470RockHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLLVDTGHWADGVHLDRTDRLCLVCKSLDYVEDEQHFVFDCPAYSQIRSQHLHLLQHCCTIADFMTLCEPNACGGFLRECFACRKQILSV
Ga0272432_106547113300031470RockFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADSVHLDRTDRLCLLCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTVADFMILCEPNACGGCLRECFARRKQILSV
Ga0272432_109104723300031470RockEYFADVQHSSLMLYRTMQPEYKSAEYLSIVKCASNRRLSSRFRTRCHGLRVDTGRWADGVHLDRTDRLCPVCKSLDYVEDEQHFVFHCPAYSHIRSQHLHLLRHCCTIADFMTLCEPDACGGFLRECFACRKQILSV
Ga0272432_110216333300031470RockMHLSTMQMFSTVLYRTMQPEYKSAEYLSVVKCASNIRLISRFRTGCHGLRVDTGRWADDVHLDRTDRLCLVCKSLDCVEDEQHFVLYCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGFLRECFACRKQILSV
Ga0272432_112492823300031470RockVVFDIASIIERVKHQHAFEYFADDQHSSLMLYRTMQLEYEPAAYLSVVKCVSNRRLISRFRTGCHGPRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLGLLQHCCTIAD
Ga0272432_113649913300031470RockMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTERWADGVHLDRTDRLCLVCKSLDYVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMTLCEANACGGF
Ga0272432_115184223300031470RockSKHLSTLQMFSTAACLCNSFRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLWVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNASGGFLRECFACRKQILSV
Ga0272432_118173413300031470RockHNFDIASVIERAKHQHAFEYFADIQHSSLVSYRTLQPEYKYAEYLSVVKCVSNRRLISRFRTVCHGLRVDTGRWADGVHLVRTDRLCLVCKALDCVEDEQHFIFDCPAYSHIRSQHLDLLQHCCTIADFMSLCEPNACGGFLRECFACRKQILTV
Ga0272432_121817313300031470RockIERAKHQHAFEYFADVQHSSSMSYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVQDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFTILCEPNACGGFLRECFACRKQILSV
Ga0272432_127477123300031470RockLHSVIERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCVSNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLGCVDYEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNAC
Ga0272439_1015211103300031471RockPEYKSAEYLSVVKCASNRRLTSRFRTGCHGLRLDTGRWADGVHLDRTDRLCLVCKSLICVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGVLRESFACRKQILSV
Ga0272439_103509333300031471RockMLYRTMQPEYKAAEHLSVVKCVSSRRLVSSFRTRCHGPRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYIHIRSQHLDILQHYCTTAHFVSLCEPNSCGGFFRECFACRKQNEFTELLIV
Ga0272439_103598883300031471RockADVQHSSLMLYRTMQPEYKSAKYLSVVKCASNRRLISRFRTGCHGLRVDTGRYADAFHLDRTDRLCLVCKSLDYVEDEQHFVFDRPAYSHIRSQNLDILQDCCTIADFMTLCEPNACGAFLRECFACRKQILSV
Ga0272439_104668513300031471RockFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISSFRTGCHGLRGDTGRWADGVHLDRTDRLCLVCKSLHYVEDEQHFVVDCPAYSHIRSQHLDLLQHCCTIADFATLCEANACGGSLRECFACRKQISSV
Ga0272439_106525613300031471RockDDQHSSLMLYRTMQLEYKPAEYLSVVKCVSNRRLISRFRTGWHGLRVDTGRWADLCHLDRTDRLCLVCKSLDCVGDEQHFVFDCPPYSHIRSQHLGLLQHCCTIADFMTLCEPNACGGFLRECFACRKQILSV
Ga0272439_108305613300031471RockVIERVKHQHAFEYFADDQHSSLMLYRTMQLEYKPAEYLSVVKCVSNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVYKSLDCVEDDQHFVFDCPAYSHIRSQHLGLLQHCCTIADFMTLCEPNACGGFLRECFACRKQILSV
Ga0272439_111982433300031471RockHGHLGQQQLFHKFDIASVIERVKHQHAFEYFADDQHSSLMLYRTMQLEYKPAEYLSVVKCVSNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLGLLQHCCTIADFMTLCEPNACGGFLRECFACRKQILSV
Ga0272439_115202813300031471RockTAVKDSWQHYLGDFLHGHLGQQQLFHNFDIASVIERAKHQHALEYFADIQHSSLMLYRTMQPGYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVRLDRTDRLCLVCKSLDYVEDEQHFVFDCPAYSHIGSQHLILLQHCCTIADFMTLCEPKACGGLLRECFACRKQILSV
Ga0272439_119565213300031471RockQLFHNFDIASVIERAKHQHAFEYIADIQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFLFDCPAYSHIRSQHLDLLQHCCTILQTL
Ga0272439_121338223300031471RockMLYRTMQPEYKSAEYLSVVKCVSNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQQFVFDCPAYSHIRSQHLDLLQHCCTNADFMSLCEANTCSGFLRE
Ga0272439_129485213300031471RockLFHNFDIASVIERAKHQHAFEYFADIQHSSLVSYRTLQPEYKYAEYLSVVKCVSNRRLISRFRTVCHGLRVDTGRWADGVHLVRTDRLCLVCKALDCVEDEQHFIFDCPAYSHIRSQHLDLLQHCCTIADFMSLCEPNACGGFLRECFACRKQILTV
Ga0272439_134871913300031471RockHLGQQQLFLNFDIASVIERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRTGCHGLRVDTGRWADGVHLDRTDRQCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHWDLLQHCCTICLYFFV
Ga0272434_102351513300031473RockMQLEYEPAEYLSVVKCASNRRLISRFRTGCHGLRLDTGRWADSVHLDRTDRLCLLGRSLDCVEDEQHFVFDCPGYSHIRSKHLDLLQHCCTIADFMALCESNAYGGFLRECFASCPSGHLKKH
Ga0272434_104036013300031473RockMVILGQQQLFHKFDFASVIKRVKHQHAFEHLADDHHSSLMLYRTMQLEYNPAEYLSVVKCVSNRRLISRFRTGCHGLRVDTGCWADGVHLDRTDRLCLVCKSLDYVEDEQHFVFDCPAYSHIRSQHLGLLQHCCNIADFMTLCEPNACGGLLRECFACRKQILSV
Ga0272434_104537943300031473RockMQLEYRPAEYLSVVKCASNRRLISRFRTGCHGLWVDTGRWADGVHLGRTDRLCLVCRSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMTLCEPNACGGFLRECFACRKQILS
Ga0272434_107863313300031473RockAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRRDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQQLDLLQHCCTIADFMILCEPNACGGFFRECFAYRKQILSV
Ga0272434_109142733300031473RockVTKKFQSKHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRCRNGCHGPRVDTGRWADGVHLDRTDRLCLVCKSLDYVEDEQHFVFDCPAYSHIRPHLDLLQHCCTIADFMTLCEPNACGGFLRECFACRKQILSV
Ga0272434_109405233300031473RockAKHQHAFEYFADVQHSSLMLYRTMQPEYKAAEYLSVVKCASNRRLISRFRTECHGLQVDTGRWADCVHLDKTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMTLCEPNACGGFLRECFECRKQILSV
Ga0272434_110767523300031473RockMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFM
Ga0272434_111789613300031473RockFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLQVDTGRWADGVHLDRTDRLCLVCQSLDYVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMTLCEPNACGGFLRECFACRKQILSV
Ga0272434_111935113300031473RockPNFDIASVIERAKHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCQGVRVDTGRWADGVHLDRTDRLCRVCKSLDSVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGFLREFFACRK
Ga0272434_117835613300031473RockTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVQDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFTILCEPNACGGFLRECFACRKHILSV
Ga0272434_128055523300031473RockHTRHTREDRLQCNALCYISVVKCVSNRRLISRFRTGCHGLRVNTGRWADGVHLDRTDRLCLVCKSLDCVEDKQHFVFDCPAYSHIRSQHLDLLQHCCAIADFMSLCEPNACGDFLRKCFACRKQILTV
Ga0272428_130405413300031520RockLAALSKWFSAWSLRTAAAFHNFDIASVERAKHQHAFEYFAVVQHSSLMLYRTMQPEYKYAEYLSVVKCVSNRRLIRWFRTGWHGLCVDTGRQACADGVHLDRTDRLCLVCKSLDCVENEQHFVQICPAYSHIRSQHLDLLQHCCTIA
Ga0272421_100552773300031909RockHNFDIASVIERAKHQHAFEYFADVQHSSLMLYRTIQPEYKSAVYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLGYVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMTLCEPNACGGFLRECFACRKQILSV
Ga0272421_100773313300031909RockERAKHQHAFEYFADIQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTGRLCLVCKSLDCVEDEQHFVFNCPAYSHIRSQHLDLLQHSCTIADFMILCERNACGGFLRECFACRKQILSV
Ga0272421_101089513300031909RockTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHDLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGFLRECFACRKQILSV
Ga0272421_101255213300031909RockHAFEYFADIQHSSLMLYRTMQPEYKPAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDRVEDEQHFVFDCPAYSHIRSQHLNLLQHCCTIADFMTLCEPNACGGFLRECFACRKQILSV
Ga0272421_101549483300031909RockMFSTAACLCNSFRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLWVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNASGGFLRECFACRKQILSV
Ga0272421_102626233300031909RockMHLYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASSRMLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDYVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFKTMCGPNAWGGFLRECFACRKQTLSV
Ga0272421_102635143300031909RockMLYRTMQPEYKSAEYLSVVKCASNRRLIGRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILGEPNACGGFLRECFACRKPILSV
Ga0272421_103283443300031909RockQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLVSRFRTGCHGPRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDKQHFVFDCPAYSHIRSQHLDLLQHCCTIAVFMILCEPNACGGFLRC
Ga0272421_104272413300031909RockHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGFLRECFACRKQVLTV
Ga0272421_104404323300031909RockYRTVQPEYKSAEYLSVVKCVSNRRLISRFRTGCHGLRGDTGRRADGVHLDRTDRLCLVCKLLDCVEDEQHYVFDRPAYCHIRSQHLDLLQHCCTMADFMFLCEPNACGGFLRECFACRKQILTV
Ga0272421_104564423300031909RockMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTERWADGVHLDRTDRLCLVCKSLDYVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMTLCEANACGGFLRECFACRRQILSV
Ga0272421_105164743300031909RockEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLTSRFRTGCHGLRLDTGRWADGVHLDRTDRLCLVCKSLICVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGVLRESFACRKQILSV
Ga0272421_106725613300031909RockFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGFFRECFACRKQILSV
Ga0272421_107995713300031909RockLMLYRTMQPEYKSAEHLSVVKCASDRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILCEPNACGGFLRECFACRKQILSV
Ga0272421_111090913300031909RockLGQQQLFHNFDIASVIERAKHQHAFEYFADIQHSSLMLYRTIHPEYKSAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRIDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQHCCTIADFMILYEPNACGGSLRECFACRKQILSV
Ga0272424_1001079443300032162RockMQLEYKPAEYLSVVKCASNRRLISRFRTGCHGLRLDTGRWAGSVLLDRTDRLCLVCKSLDCVEDEQHFVFDCPAYSHIRSQHLDLLQYCCTIADFMTLCESNAYGGFP
Ga0272424_102208713300032162RockIERVKHQHAFEYFADDQHSSLMLYRTMQLEYKPAEYLSVVKCVSNRRLISRFRTGWHGLRVDTGRWADLCHLDRTDRLCLVCKSLDCVGDEQHFVFDCPPYSHIRSQHLGLLQHCCTIADFMTLCEPNACGGFLRECFACRKQILSV
Ga0272424_112867113300032162RockMRQLAALSRRFSAWSFRTSAAFHKFDIASVIERAKHQHAFEYFADDQHSSLMLYRTMQPEYKPAEYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVHLDRTYRLCLVCKSLDCVEDEQHFVFDCPAYNHIRSQHLDLLQHCCTIADFMALCEPNTCGGFLRECFACRKQILSV
Ga0272431_1004694123300033181RockMRLFDIASVIERAKHQHAFEYFADVQHSSLMLYRTKQPEYKSAEYLSVVKCASNRRLISRFRTGCHDLRVDTGRWANGVHLDRTDRLCLVCKSLDCVEDEQHFVFYCPAYSHIRSQHLDLLQHCCTIADFMTLCEPNACGGFLRGCFARRKQILSL
Ga0272431_1004777713300033181RockHQHAFEYFADVQHSSLMLYRTMQPEYKSAEYLSVVKCASNRRLISSFRTGCHGLRGDTGRWADGVHLDRTDRLCLVCKSLHYVEDEQHFVVDCPAYSHIRSQHLDLLQHCCTIADFATLCEANACGGSLRECFACRKQISSV
Ga0272431_1008329213300033181RockPEYKSAEYLSVVKCASNRRLISRFTTGCHGLRVDTGRWADGVHLDRTDRLGLVCKSLDCVENEHHFVLYCPAYSHIRSQHLDLLQHCCTIADFMILCEANACGGFLRESFACRKQILSV
Ga0272431_1023193913300033181RockSVMERAKHQHAFEYFADVQHNSLMLCRTMQPEYKSAVYLSVVKCASNRRLISRFRTGCHGLRVDTGRWADGVRLDRTDRLCLVCKSLDYVEDEQHFVFDCPAYSHIGSQHLILLQHCCTIADFMTFCEPKACGGLLRECFACRKQILSV
Ga0272431_1048150213300033181RockNHQHAVEFKLEYFADIQHSSLMLYRTMQPEYKSAEYLSVVKCVSNRRLISRFRTGCHGLRVDTGRWADGVHLDRTDRLCLVCKSLDCVEDEQQFVFDCPAYSHIRSQHLDLLQHCCTNADFMSLCEANTCSGFLREFFACRKQILTV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.