| Basic Information | |
|---|---|
| Taxon OID | 3300031410 Open in IMG/M |
| Scaffold ID | Ga0228543_106353 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of Chrysochromulina tobin associated microbial communities from unialgal haptophyte culture, Seattle, Washington, United States ? P5_L6_8mM_1 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 818 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina brevifila | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Chrysochromulina Tobin Associated Microbial Communities From Unialgal Haptophyte Culture In Seattle, Washington, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Washington | |||||||
| Coordinates | Lat. (o) | 47.6519 | Long. (o) | -122.3113 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022338 | Metagenome / Metatranscriptome | 214 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0228543_1063531 | F022338 | N/A | VFHLIMLLTDIDAAPALPASEDVIRVGRRVLGMGPMDARLYVLSCFVNLAYLGGAGQLRLPPDGVDKSAMEVLFDTLLLTQESESVLFYSVAGLYNLSNDASFAQMAATKKGVLAKLHSLAESANPDTVKYASGTVDNWRKHHSGAWPPQ |
| ⦗Top⦘ |