| Basic Information | |
|---|---|
| Taxon OID | 3300031366 Open in IMG/M |
| Scaffold ID | Ga0307506_10257340 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 666 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Washington | |||||||
| Coordinates | Lat. (o) | 47.6684 | Long. (o) | -121.924 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077879 | Metagenome / Metatranscriptome | 117 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307506_102573401 | F077879 | AGG | VLAERTAVVADVQPYEVHGSRHMTVALAFADGTFAQAQLGAESVPEGLRAGDAVIVKLAMSVVVALERPPAPAAP |
| ⦗Top⦘ |