Scaffold Ga0307498_10155075

Overview

Basic Information

• Taxon OID: 3300031170
• Scaffold ID: Ga0307498_10155075
• Source Dataset Name: Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 764
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 45.654
  • Long. (^o): -122.839

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072399	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307498_101550751	F072399	N/A	MQAKATSAAVCPECGTRLAGGFSRNLGRCMICLLRVGFDDAEEP