Scaffold Ga0228577_117424

Overview

Basic Information

• Taxon OID: 3300031165
• Scaffold ID: Ga0228577_117424
• Source Dataset Name: Metatranscriptome of Chrysochromulina tobin associated microbial communities from unialgal haptophyte culture, Seattle, Washington, United States ? P3_L6_16mM_2 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 522
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Chrysochromulina Tobin Associated Microbial Communities From Unialgal Haptophyte Culture In Seattle, Washington, Usa

Source Dataset Sampling Location

• Location Name: USA: Washington
• Coordinates
  • Lat. (^o): 47.6519
  • Long. (^o): -122.3113

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035605	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0228577_1174241	F035605	N/A	REWLMTWEMLQLSALPGFPLWEKDVHDVLAGNLESLTSIFRAYAASSLEGSATEMDMEEFHDFVIEAGLITDMYSFDTMSGQFTKANAGSNDTVLELHEFLTMLVRISFFRANPQYGMRKGKDQKNADQFATVPLPDCLIRMLSEQVIPNARDEDYSQRFADKILTLSEVQGA