Scaffold Ga0308161_1023897

Overview

Basic Information

• Taxon OID: 3300031087
• Scaffold ID: Ga0308161_1023897
• Source Dataset Name: Phyllosphere microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLF.R2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4000
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere → Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 37.8864
  • Long. (^o): -122.2981

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009686	Metagenome / Metatranscriptome	314	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308161_10238973	F009686	GAGG	MTEREMFEASFKRPTDYFKRSSQSQWSIDADLGILDWRGSDLSEEDLTRFHAHYDK