NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300031087

3300031087: Phyllosphere microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLF.R2



Overview

Basic Information
IMG/M Taxon OID3300031087 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133512 | Gp0324017 | Ga0308161
Sample NamePhyllosphere microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLF.R2
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size762496494
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius1
All Organisms → Viruses → Predicted Viral1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameLeaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States
TypeHost-Associated
TaxonomyHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere → Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: California
CoordinatesLat. (o)37.8864Long. (o)-122.2981Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009686Metagenome / Metatranscriptome314Y
F057078Metagenome / Metatranscriptome136Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0308161_1000030Not Available443077Open in IMG/M
Ga0308161_1023897All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius4000Open in IMG/M
Ga0308161_1026646All Organisms → Viruses → Predicted Viral3710Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0308161_1000030Ga0308161_1000030326F009686MTEREMFESSFKRPTDYFKRSSQSQWNIDSDLGILDWTGSDLSEEDMIRFKAHYEK
Ga0308161_1023897Ga0308161_10238973F009686MTEREMFEASFKRPTDYFKRSSQSQWSIDADLGILDWRGSDLSEEDLTRFHAHYDK
Ga0308161_1026646Ga0308161_10266465F057078MAIKKATTTDDLNKEETPKTEGYTTLVGPSGVETSVPDSILEALLDSGYKKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.