| Basic Information | |
|---|---|
| Taxon OID | 3300030721 Open in IMG/M |
| Scaffold ID | Ga0308133_1032869 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 706 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Western Arctic Ocean | |||||||
| Coordinates | Lat. (o) | 74.0136 | Long. (o) | -139.5971 | Alt. (m) | Depth (m) | 20 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003442 | Metagenome / Metatranscriptome | 486 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0308133_10328691 | F003442 | N/A | MKFTIALACFLGYTQAITLWTTTGEIAYEESDEETENIQLNDWHAGQTGTLGNAEYARVVTPRFAADDDDIFMRSMIKNFAIEKSTEGTEEHPSVPTGKFVMNEATMRAAAQEVLCTHKGLCGAALSSYMNTYFGKSWGHFDVNKTGEVEVIKSPQFMRFLASDQYMSLQ |
| ⦗Top⦘ |