NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F003442

Metagenome / Metatranscriptome Family F003442

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F003442
Family Type Metagenome / Metatranscriptome
Number of Sequences 486
Average Sequence Length 163 residues
Representative Sequence MKFAILALLGVASTKTTLYTTRGEIAYEEPEDLVQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Number of Associated Samples 189
Number of Associated Scaffolds 486

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 5.76 %
% of genes near scaffold ends (potentially truncated) 84.36 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 177
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(39.300 % of family members)
Environment Ontology (ENVO) Unclassified
(65.638 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(81.481 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 39.90%    β-sheet: 9.84%    Coil/Unstructured: 50.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006356|Ga0075487_1371113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300006356|Ga0075487_1402867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300006356|Ga0075487_1423235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium682Open in IMG/M
3300006374|Ga0075512_1295865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300006379|Ga0075513_1353695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300006384|Ga0075516_1335743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300006384|Ga0075516_1372642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300006393|Ga0075517_1449146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300006393|Ga0075517_1522347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium711Open in IMG/M
3300006397|Ga0075488_1567626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300006397|Ga0075488_1593080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300006402|Ga0075511_1585143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300006404|Ga0075515_10779432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300006425|Ga0075486_1729682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300007513|Ga0105019_1155013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1185Open in IMG/M
3300007513|Ga0105019_1241391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium840Open in IMG/M
3300009269|Ga0103876_1061420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300009274|Ga0103878_1021153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium682Open in IMG/M
3300009276|Ga0103879_10038035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300009436|Ga0115008_10950676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300009441|Ga0115007_10335068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium984Open in IMG/M
3300009441|Ga0115007_10341949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium974Open in IMG/M
3300009441|Ga0115007_10615908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium723Open in IMG/M
3300009593|Ga0115011_11456978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300009606|Ga0115102_10181846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300009606|Ga0115102_10328730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300009606|Ga0115102_10804994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium705Open in IMG/M
3300009606|Ga0115102_10831284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300009677|Ga0115104_10120015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300009677|Ga0115104_10125702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300009677|Ga0115104_10373493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300009677|Ga0115104_10386822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300009677|Ga0115104_10446005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium716Open in IMG/M
3300009677|Ga0115104_10461196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300009677|Ga0115104_10631521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300009677|Ga0115104_10646782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300009677|Ga0115104_10858781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300009677|Ga0115104_10908848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300009677|Ga0115104_10984318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300009677|Ga0115104_11036126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300009677|Ga0115104_11092846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300009677|Ga0115104_11093933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300009677|Ga0115104_11109754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium730Open in IMG/M
3300009677|Ga0115104_11130928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300009677|Ga0115104_11164033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300009677|Ga0115104_11187634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300009679|Ga0115105_10986372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium678Open in IMG/M
3300009679|Ga0115105_11022004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300009679|Ga0115105_11211284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300009679|Ga0115105_11382877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300009750|Ga0123368_1055495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300010981|Ga0138316_10564098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300010981|Ga0138316_10961101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300010981|Ga0138316_11372072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300010981|Ga0138316_11511283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300010981|Ga0138316_11668199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300010984|Ga0138323_10737758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium683Open in IMG/M
3300010984|Ga0138323_11462300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300010985|Ga0138326_10149794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300010985|Ga0138326_10304727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300010985|Ga0138326_10576321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300010985|Ga0138326_10859360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300010985|Ga0138326_10959903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300010985|Ga0138326_12026262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300010987|Ga0138324_10347031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium718Open in IMG/M
3300010987|Ga0138324_10443600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300010987|Ga0138324_10452271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300010987|Ga0138324_10631913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300010987|Ga0138324_10668498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300010987|Ga0138324_10702486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300010987|Ga0138324_10719886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300012953|Ga0163179_10372468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1151Open in IMG/M
3300017735|Ga0181431_1133599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300017751|Ga0187219_1219965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300018617|Ga0193133_1016070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium629Open in IMG/M
3300018622|Ga0188862_1018342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300018622|Ga0188862_1018394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300018622|Ga0188862_1022556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300018628|Ga0193355_1015799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300018628|Ga0193355_1026649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300018692|Ga0192944_1039552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300018716|Ga0193324_1035930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300018730|Ga0192967_1065175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300018742|Ga0193138_1036027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300018742|Ga0193138_1044449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300018742|Ga0193138_1056570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300018765|Ga0193031_1036762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium788Open in IMG/M
3300018765|Ga0193031_1047594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium710Open in IMG/M
3300018765|Ga0193031_1048612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium703Open in IMG/M
3300018765|Ga0193031_1049926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium695Open in IMG/M
3300018765|Ga0193031_1052168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium682Open in IMG/M
3300018765|Ga0193031_1055283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300018765|Ga0193031_1062527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300018765|Ga0193031_1062638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300018765|Ga0193031_1063654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum622Open in IMG/M
3300018765|Ga0193031_1081667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300018779|Ga0193149_1043095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300018779|Ga0193149_1044085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300018779|Ga0193149_1047741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300018779|Ga0193149_1047893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300018779|Ga0193149_1053364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300018791|Ga0192950_1060115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300018796|Ga0193117_1054737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium666Open in IMG/M
3300018855|Ga0193475_1040201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium749Open in IMG/M
3300018855|Ga0193475_1042892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300018862|Ga0193308_1058196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300018871|Ga0192978_1061009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium701Open in IMG/M
3300018871|Ga0192978_1064644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300018871|Ga0192978_1078687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300018913|Ga0192868_10034690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium733Open in IMG/M
3300018913|Ga0192868_10045338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium666Open in IMG/M
3300018913|Ga0192868_10054017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300018928|Ga0193260_10074688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium734Open in IMG/M
3300018928|Ga0193260_10078454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300018928|Ga0193260_10089967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300018928|Ga0193260_10096838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300018934|Ga0193552_10175204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300018967|Ga0193178_10048714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300018967|Ga0193178_10077724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300018968|Ga0192894_10178694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium695Open in IMG/M
3300018968|Ga0192894_10223965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium626Open in IMG/M
3300018968|Ga0192894_10225647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300018968|Ga0192894_10263925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300018974|Ga0192873_10377089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300018977|Ga0193353_10158598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300018977|Ga0193353_10172282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300018977|Ga0193353_10183256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300018980|Ga0192961_10193329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300018980|Ga0192961_10258073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300018982|Ga0192947_10135883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium821Open in IMG/M
3300018982|Ga0192947_10151260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium774Open in IMG/M
3300018982|Ga0192947_10178392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300018982|Ga0192947_10179272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300018982|Ga0192947_10276986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300018988|Ga0193275_10242090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300018989|Ga0193030_10131094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium799Open in IMG/M
3300018989|Ga0193030_10142419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium771Open in IMG/M
3300018989|Ga0193030_10146152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium762Open in IMG/M
3300018989|Ga0193030_10146679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium761Open in IMG/M
3300018989|Ga0193030_10148943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium756Open in IMG/M
3300018989|Ga0193030_10153483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium746Open in IMG/M
3300018989|Ga0193030_10160368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium731Open in IMG/M
3300018989|Ga0193030_10163199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300018989|Ga0193030_10163288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300018989|Ga0193030_10174532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium703Open in IMG/M
3300018989|Ga0193030_10175953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300018989|Ga0193030_10179052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium694Open in IMG/M
3300018989|Ga0193030_10181236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300018989|Ga0193030_10181344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300018989|Ga0193030_10182806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300018989|Ga0193030_10183529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300018989|Ga0193030_10184611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300018989|Ga0193030_10184712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300018989|Ga0193030_10188685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300018989|Ga0193030_10195273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300018989|Ga0193030_10195889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300018989|Ga0193030_10196550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300018989|Ga0193030_10217183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium629Open in IMG/M
3300018989|Ga0193030_10237797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300018989|Ga0193030_10252231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300018989|Ga0193030_10253021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300018989|Ga0193030_10254336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300018989|Ga0193030_10254352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300018989|Ga0193030_10273104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300018989|Ga0193030_10289953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300018989|Ga0193030_10289969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300018989|Ga0193030_10290054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300018989|Ga0193030_10298376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300019001|Ga0193034_10117526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300019001|Ga0193034_10129945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300019001|Ga0193034_10134570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300019010|Ga0193044_10200070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300019010|Ga0193044_10229671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300019021|Ga0192982_10313049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300019022|Ga0192951_10163985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium793Open in IMG/M
3300019024|Ga0193535_10257278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300019027|Ga0192909_10231120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300019031|Ga0193516_10158957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium761Open in IMG/M
3300019031|Ga0193516_10169297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium733Open in IMG/M
3300019031|Ga0193516_10186337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium692Open in IMG/M
3300019031|Ga0193516_10234913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300019031|Ga0193516_10245104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300019031|Ga0193516_10254841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300019032|Ga0192869_10251848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium764Open in IMG/M
3300019032|Ga0192869_10265484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium745Open in IMG/M
3300019032|Ga0192869_10266079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium744Open in IMG/M
3300019032|Ga0192869_10272674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium735Open in IMG/M
3300019032|Ga0192869_10274894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium732Open in IMG/M
3300019032|Ga0192869_10275154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium732Open in IMG/M
3300019032|Ga0192869_10277957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M
3300019032|Ga0192869_10296182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum705Open in IMG/M
3300019032|Ga0192869_10296190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium705Open in IMG/M
3300019032|Ga0192869_10296976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300019032|Ga0192869_10363327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300019032|Ga0192869_10364650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300019032|Ga0192869_10424415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300019032|Ga0192869_10443861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300019032|Ga0192869_10459139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300019033|Ga0193037_10201883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium676Open in IMG/M
3300019033|Ga0193037_10234655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300019033|Ga0193037_10248502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300019033|Ga0193037_10260946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300019036|Ga0192945_10274369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300019037|Ga0192886_10302341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300019039|Ga0193123_10409941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300019045|Ga0193336_10270302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium730Open in IMG/M
3300019045|Ga0193336_10270353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium730Open in IMG/M
3300019045|Ga0193336_10403883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300019045|Ga0193336_10405707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300019045|Ga0193336_10425330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300019045|Ga0193336_10592738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300019045|Ga0193336_10599001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300019048|Ga0192981_10215014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium746Open in IMG/M
3300019048|Ga0192981_10220821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium734Open in IMG/M
3300019048|Ga0192981_10221246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium733Open in IMG/M
3300019048|Ga0192981_10237524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium701Open in IMG/M
3300019048|Ga0192981_10254579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300019049|Ga0193082_10516329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300019049|Ga0193082_10615203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300019050|Ga0192966_10168979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium780Open in IMG/M
3300019050|Ga0192966_10218147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300019051|Ga0192826_10284150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300019051|Ga0192826_10355781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300019095|Ga0188866_1028478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300019097|Ga0193153_1019008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium709Open in IMG/M
3300019099|Ga0193102_1016674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum679Open in IMG/M
3300019103|Ga0192946_1039494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium709Open in IMG/M
3300019103|Ga0192946_1039610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium708Open in IMG/M
3300019116|Ga0193243_1053006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300019117|Ga0193054_1040279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300019118|Ga0193157_1016462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium733Open in IMG/M
3300019118|Ga0193157_1018248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium703Open in IMG/M
3300019118|Ga0193157_1021760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300019118|Ga0193157_1022012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300019118|Ga0193157_1026719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300019118|Ga0193157_1033885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300019123|Ga0192980_1062463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium701Open in IMG/M
3300019123|Ga0192980_1085177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300019125|Ga0193104_1034964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300019125|Ga0193104_1039577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300019125|Ga0193104_1057125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300019129|Ga0193436_1066613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300019133|Ga0193089_1100401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium680Open in IMG/M
3300019149|Ga0188870_10094450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium721Open in IMG/M
3300019149|Ga0188870_10108106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300019149|Ga0188870_10110426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300021169|Ga0206687_1850802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300021291|Ga0206694_1015623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300021345|Ga0206688_10628219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium744Open in IMG/M
3300021345|Ga0206688_10872011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium743Open in IMG/M
3300021345|Ga0206688_10885928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium758Open in IMG/M
3300021345|Ga0206688_10900803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300021348|Ga0206695_1060665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium692Open in IMG/M
3300021348|Ga0206695_1269445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300021348|Ga0206695_1420623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300021350|Ga0206692_1873004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300021355|Ga0206690_10292874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300021355|Ga0206690_10394658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300021355|Ga0206690_10720836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300021355|Ga0206690_10807392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300021355|Ga0206690_10837850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300021359|Ga0206689_10446131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300021359|Ga0206689_10785432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium733Open in IMG/M
3300021866|Ga0063109_104497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300021869|Ga0063107_100954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300021869|Ga0063107_100960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300021869|Ga0063107_107614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300021872|Ga0063132_101084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300021872|Ga0063132_105528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300021872|Ga0063132_107209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300021872|Ga0063132_107975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300021880|Ga0063118_1004226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300021881|Ga0063117_1011505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300021881|Ga0063117_1030939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300021885|Ga0063125_1006469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300021885|Ga0063125_1008484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300021885|Ga0063125_1009964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300021885|Ga0063125_1013554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300021887|Ga0063105_1014858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300021887|Ga0063105_1035306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300021898|Ga0063097_1006588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300021898|Ga0063097_1010876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300021902|Ga0063086_1001688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300021902|Ga0063086_1002380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300021910|Ga0063100_1069365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300021911|Ga0063106_1135492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300021912|Ga0063133_1012886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium606Open in IMG/M
3300021912|Ga0063133_1030159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300021912|Ga0063133_1044564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300021913|Ga0063104_1036183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300021924|Ga0063085_1018621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300021925|Ga0063096_1006787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300021925|Ga0063096_1007519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300021925|Ga0063096_1008049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300021925|Ga0063096_1015711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium713Open in IMG/M
3300021925|Ga0063096_1019164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300021925|Ga0063096_1021546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300021925|Ga0063096_1026974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300021928|Ga0063134_1101412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300021939|Ga0063095_1004694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300021939|Ga0063095_1053095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300021941|Ga0063102_1025515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300021941|Ga0063102_1029386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300021941|Ga0063102_1036490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300021941|Ga0063102_1042100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300021943|Ga0063094_1001072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300021943|Ga0063094_1012458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300021943|Ga0063094_1025221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300021943|Ga0063094_1041189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300021950|Ga0063101_1012534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300021950|Ga0063101_1045035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300021950|Ga0063101_1081202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300021950|Ga0063101_1172088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300021950|Ga0063101_1225918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300021957|Ga0222717_10615684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium567Open in IMG/M
3300021959|Ga0222716_10299256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium972Open in IMG/M
3300023679|Ga0232113_1024900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300023695|Ga0228680_1027285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300023696|Ga0228687_1028248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300023698|Ga0228682_1039153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300023701|Ga0228685_1058277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300023704|Ga0228684_1051931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M
3300026403|Ga0247557_1032399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300026420|Ga0247581_1083220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300026434|Ga0247591_1066564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium682Open in IMG/M
3300026447|Ga0247607_1056142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium688Open in IMG/M
3300026448|Ga0247594_1032044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium887Open in IMG/M
3300026448|Ga0247594_1075686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300026449|Ga0247593_1082901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300026461|Ga0247600_1106268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300026462|Ga0247568_1075543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300026462|Ga0247568_1082746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300026468|Ga0247603_1123056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300026470|Ga0247599_1088312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300026471|Ga0247602_1132654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300026500|Ga0247592_1114336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300026500|Ga0247592_1120450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium629Open in IMG/M
3300026500|Ga0247592_1161326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300026503|Ga0247605_1168313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300026504|Ga0247587_1103485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium701Open in IMG/M
3300026504|Ga0247587_1115142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300026504|Ga0247587_1115700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300026504|Ga0247587_1124452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300026513|Ga0247590_1116868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300026513|Ga0247590_1131942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300026513|Ga0247590_1162753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300026513|Ga0247590_1168717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300027810|Ga0209302_10186474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium999Open in IMG/M
3300027810|Ga0209302_10196972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium966Open in IMG/M
3300028102|Ga0247586_1066379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum680Open in IMG/M
3300028106|Ga0247596_1081244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum730Open in IMG/M
3300028106|Ga0247596_1105073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300028106|Ga0247596_1159076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300028110|Ga0247584_1137851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium604Open in IMG/M
3300028134|Ga0256411_1127006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum853Open in IMG/M
3300028134|Ga0256411_1187709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300028134|Ga0256411_1188027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300028134|Ga0256411_1195499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300028134|Ga0256411_1212209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300028134|Ga0256411_1216471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300028134|Ga0256411_1222412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300028134|Ga0256411_1255626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300028137|Ga0256412_1216946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium706Open in IMG/M
3300028137|Ga0256412_1226844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300028137|Ga0256412_1236804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300028137|Ga0256412_1256143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300028137|Ga0256412_1267475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum630Open in IMG/M
3300028137|Ga0256412_1368320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300028233|Ga0256417_1119105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium711Open in IMG/M
3300028233|Ga0256417_1134814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300028233|Ga0256417_1141578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300028233|Ga0256417_1203485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300028250|Ga0247560_118049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300028282|Ga0256413_1215096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum687Open in IMG/M
3300028282|Ga0256413_1233144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300028282|Ga0256413_1246693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300028282|Ga0256413_1265685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum607Open in IMG/M
3300028282|Ga0256413_1308784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300028282|Ga0256413_1345913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300028290|Ga0247572_1110609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium680Open in IMG/M
3300028290|Ga0247572_1115450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300028290|Ga0247572_1147913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300028333|Ga0247595_1062348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300028334|Ga0247597_1037451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300028334|Ga0247597_1039471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300028334|Ga0247597_1041083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300028334|Ga0247597_1055066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300028335|Ga0247566_1056481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300028335|Ga0247566_1057469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300028335|Ga0247566_1083311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300028575|Ga0304731_10117093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300028575|Ga0304731_10737758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium683Open in IMG/M
3300028575|Ga0304731_11131403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300028575|Ga0304731_11336725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300028575|Ga0304731_11462300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300028575|Ga0304731_11619171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300030670|Ga0307401_10116139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1168Open in IMG/M
3300030670|Ga0307401_10382198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300030671|Ga0307403_10574143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300030671|Ga0307403_10786830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300030699|Ga0307398_10569560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium626Open in IMG/M
3300030702|Ga0307399_10368136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300030702|Ga0307399_10419714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300030702|Ga0307399_10516893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300030709|Ga0307400_11003765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300030720|Ga0308139_1067778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300030721|Ga0308133_1032869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium706Open in IMG/M
3300030721|Ga0308133_1058963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300030724|Ga0308138_1042358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300030724|Ga0308138_1067460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300030725|Ga0308128_1030626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300030780|Ga0073988_10009299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300030780|Ga0073988_10017443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300030780|Ga0073988_12258508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300030780|Ga0073988_12322114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300030780|Ga0073988_12328379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300030780|Ga0073988_12363450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300030781|Ga0073982_11700558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300030781|Ga0073982_11749495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300030912|Ga0073987_11188355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300030912|Ga0073987_11226145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300030912|Ga0073987_11228776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300031062|Ga0073989_13447662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300031062|Ga0073989_13583304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300031062|Ga0073989_13605854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300031062|Ga0073989_13608065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300031522|Ga0307388_10565034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium753Open in IMG/M
3300031522|Ga0307388_10721414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300031542|Ga0308149_1032091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300031556|Ga0308142_1044387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300031556|Ga0308142_1072467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300031557|Ga0308148_1036451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300031579|Ga0308134_1095357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300031579|Ga0308134_1152308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300031579|Ga0308134_1164057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300031622|Ga0302126_10123839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium984Open in IMG/M
3300031622|Ga0302126_10233949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300031626|Ga0302121_10079115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium984Open in IMG/M
3300031674|Ga0307393_1098903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300031709|Ga0307385_10218186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300031709|Ga0307385_10365134All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium551Open in IMG/M
3300031709|Ga0307385_10369490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300031709|Ga0307385_10384427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300031710|Ga0307386_10390666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum714Open in IMG/M
3300031710|Ga0307386_10476122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300031710|Ga0307386_10487116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300031710|Ga0307386_10579659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300031710|Ga0307386_10659520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300031725|Ga0307381_10257278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300031729|Ga0307391_10377832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium782Open in IMG/M
3300031734|Ga0307397_10395796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M
3300031734|Ga0307397_10401573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300031738|Ga0307384_10361738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300031738|Ga0307384_10368365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300031738|Ga0307384_10458807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium599Open in IMG/M
3300031738|Ga0307384_10527670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300031738|Ga0307384_10592121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300031739|Ga0307383_10404805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300031739|Ga0307383_10413578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300031739|Ga0307383_10446297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300031739|Ga0307383_10658753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300031739|Ga0307383_10659894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300031739|Ga0307383_10695054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300031743|Ga0307382_10375843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300031743|Ga0307382_10400131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300031743|Ga0307382_10484424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300031743|Ga0307382_10538704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300031743|Ga0307382_10542595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300031752|Ga0307404_10363804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300032481|Ga0314668_10597330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300032518|Ga0314689_10448042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300032518|Ga0314689_10518715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300032521|Ga0314680_10633438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium675Open in IMG/M
3300032521|Ga0314680_10928176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300032540|Ga0314682_10540564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300032615|Ga0314674_10557249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300032651|Ga0314685_10570053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300032707|Ga0314687_10603413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300032714|Ga0314686_10639150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300032724|Ga0314695_1352021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300032724|Ga0314695_1422245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300032742|Ga0314710_10488624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300032746|Ga0314701_10326438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium696Open in IMG/M
3300032750|Ga0314708_10420217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300032751|Ga0314694_10282199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium710Open in IMG/M
3300032752|Ga0314700_10423212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium708Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine39.30%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine32.51%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater14.81%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.70%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.50%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.44%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.62%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.41%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.41%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.41%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006425Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009750Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_206_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010984Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 5)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300018617Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000604 (ERX1782236-ERR1711896)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018716Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001728 (ERX1789726-ERR1719299)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019099Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021291Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021866Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021869Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-135M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021880Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021885Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-19 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021911Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021943Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023695Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 21R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023701Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 47R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026403Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 2R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026434Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028250Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 8R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030781Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S7_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031556Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_538_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031557Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0075487_137111313300006356AqueousKMKFALVALLGLAQARTTLFTTMGEVAYVEEDESAAVQIDDWHPGLSGQLGAGSYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKAWGHFDVNQTGEIEVGKSPQFMRFLASDQYMSLQ*
Ga0075487_140286723300006356AqueousINFNGIIMKFAILALLGVASTKTTLYTTTGEIAYEEPENLVQLDDWAPGQHETLGASAYERVIPGRFSADDDDIFMRSMLNNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGASLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0075487_142323513300006356AqueousTMKFATLAALIGATQAITLWTTTGQIAYFEADDQDTDAMNLQLDDWHPGQHETLGASAYERVIPARFSSDDDDIFMRSMYNNYAIDKNCAGKKEDPRPCGNFVMNAATSRAAASEVLCTHKGLCGAALQSYLDTYFDKAWGHFDVNRTGEIEIIKMPQFMRFLASDQYMSLQ*
Ga0075512_129586523300006374AqueousAILALLGVASTKTTLYTTTGEIAYEEPENLVQLDDWAPGQHETLGASAYERVIPGRFSADDDDIFMRSMLNNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASDVLCTHKGLCAGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0075513_135369523300006379AqueousIMKFAILALLGVASTKTTLYTTTGEIAYEEPENLVQLDDWAPGQHETLGASAYERVIPGRFSADDDDIFMRSMLNNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGASLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0075516_133574323300006384AqueousMKFAILALLGVASTKTTLYTTTGEIAYEEPENLVQLDDWAPGQHETLGASAYERVIPGRFSADDDDIFMRSMLNNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGASLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0075516_137264223300006384AqueousLKMKFALVALLGLAQARTTLFTTMGEVAYVEEDESAAVQIDDWHPGLSGQLGAGSYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKAWGHFDVNQTGEIEVGKSPQFMRFLASDQYMSLQ*
Ga0075517_144914613300006393AqueousMKFALVALLGLAQARTTLFTTMGEVAYVEEDESAAVQIDDWHPGLSGQLGAGSYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKAWGHFDVNQTGEIEVGKSPQFMRFLASDQYMSLQ*
Ga0075517_152234713300006393AqueousELLILTTMKFATLAALIGATQAITLWTTTGQIAYFEADDQDTDAMNLQLDDWHPGQHETLGASAYERVIPARFSSDDDDIFMRSMYNNYAIDKNCAGKKEDPRPCGNFVMNAATSRAAASEVLCTHKGLCGAALQSYLDTYFDKAWGHFDVNRTGEIEIIKMPQFMRFLASDQYMSLQ*
Ga0075488_156762613300006397AqueousMKFATLAALIGATQAITLWTTTGQIAYFEADDQDTDAMNLQLDDWHPGQHETLGASAYERVIPARFSSDDDDIFMRSMYNNYAIDKNCAGKKEDPRPCGNFVMNAATSRAAASEVLCTHKGLCGAALQSYLDTYFDKAWGHFDVNRTGEIEIIKMPQFMRFLASDQYMSLQ*
Ga0075488_159308013300006397AqueousGIIMKFAILALLGVASTKTTLYTTTGEIAYEEPENLVQLDDWAPGQHETLGASAYERVIPGRFSADDDDIFMRSMLNNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGASLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0075511_158514313300006402AqueousGIIMKFAILALLGVASTKTTLYTTTGEIAYEEPENLVQLDDWAPGQHETLGASAYERVIPGRFSADDDDIFMRSMLNNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0075515_1077943213300006404AqueousLGVASTKTTLYTTTGEIAYEEPENLVQLDDWAPGQHETLGASAYERVIPGRFSADDDDIFMRSMLNNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0075486_172968213300006425AqueousLGVASTKTTLYTTTGEIAYEEPENLVQLDDWAPGQHETLGASAYERVIPGRFSADDDDIFMRSMINNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGASLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0105019_115501323300007513MarineMKFALACLLGAANAITLWTVNGEIAYEEDDEPEAMNIQLDDWHPGQHGTLGAAEYERVVPARFSSDDDDIFMRSMISNYAIDKNCAGKDDPPMPCGKFVMNEATMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ*
Ga0105019_124139113300007513MarineMKFTIAIAALLGYAQARTTLFTTHGEIAFQQEDEDDVNLQLDDWHPGQSGTLGGAEYARVTPARFSADSDDIFMRSMIQNYAIDKNCAGPDDPPAPCGKFTMNPVTMRAAASEVLCTHKGMCGGALQTYLGTYFDKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0103876_106142013300009269Surface Ocean WaterMNVQLEDWHPGQHEMLGANAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCADKDDDPRPCGKFVMNKVTMRAAAAEVLATHKGLTGDKLNNYLATYFDKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0103878_102115313300009274Surface Ocean WaterKMKFALVALLGYASARTTLFTTMGEVAYVEEDESAALQIDDWHPGLSGQLGAGAYERQTPARFSADSDDIFMRSMIENYAIDKNCAGKDDPPAPCGKFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ*
Ga0103879_1003803513300009276Surface Ocean WaterNIQLDDWHPGQHEMLGAAAYERVVPDRFSTDDDDIFMRSMIKNYAIDKNCAGKDEDPVPCGKFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYFQL*
Ga0115008_1095067613300009436MarineMKFAILALLGVVSAKTTLYRTNGEVAYEEPEDLVQLDDWHPGQTGTLGAAEYSRVVPARFASNDDDIFMRSMISNYAIEKADGDGAPTGNFVMNESTMRAAASEVLCTHKGLCAAALQTYLDTYFSKAWVHFDVNRTGAIEVIKSPQFMRFLASDQYMSLQ*
Ga0115007_1033506813300009441MarineMKFAIFALLGFTAARTTLYNMEGQITYMTEDDEVNLQLDDWHPGQSGTSGAAEYARVTPARFSADSDDIFMRSMIQNFAIDKNCAGPDDPPASCGKFTMNPVTMRAAASEVLATHKGLTGAALQTYLTTYFEKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0115007_1034194913300009441MarineMKFAILALIGAVAAKTTLYRTNGEIAYEQEDEENLMIEDWHPGQSGTLGGAEYARTTPARFSADSDDIFMRSMIQNYAIDKNCAGKDDPPAPCGTFTMNQATMRAAASEVLATHKGLAGAALQTYLDTYFSKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0115007_1061590813300009441MarineMNLQLDDWHPGQHGTLGASEYVRVVPARFSSDDDDIFMRSMINNFAIDKNCAGKDDPPAPCGTFTMNEATMRAASSEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0115011_1145697813300009593MarineMKFAIVALLGAVSAKTTVFTTRGEVAYEEPEEMIQLDDWHPGQHEMLGASAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCEEDDKKDPFPCGKFIMNQATMRAAASEVLCTHKGLCGGALATYLDTYFSKAWGHFDVNRTGEIEVIKSPQF
Ga0115102_1018184613300009606MarineTLKMKFALVALLGLAQARTTLFTTMGEVAYVEEDESAAVQIDDWHPGLSGQLGAGSYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKAWGHFDVNQTGEIEVGKSPQFMRFLASDQYMSLQ*
Ga0115102_1032873013300009606MarineKFAILALLGAVSAKTTLFTTQGEIAYEQNDDLVQIDDWHPGLSGQLGAGEYSRVTPARFATDDDDIFMRSMINNYAIETEDADKNPSGKFIMNESTMRAAASEVLCTHKGLCAGALQAYLDTYFAKAWGHFDVNRTGSVEVIKCPQFMRFLASDQYMSLQ*
Ga0115102_1080499413300009606MarineLILTTMKFATLAALIGATQAITLWTTTGQIAYFEADDQDTDAMNLQLDDWHPGQHETLGASAYERVIPARFSSDDDDIFMRSMYNNYAIDKNCAGKKEDPRPCGNFVMNAATSRAAASEVLCTHKGLCGAALQSYLDTYFDKAWGHFDVNRTGEIEIIKMPQFMRFLASDQYMSLQ*
Ga0115102_1083128413300009606MarineIINFNGIIMKFAILALLGVASTKTTLYTTTGEIAYEEPENLVQLDDWAPGQHETLGASAYERVIPGRFSADDDDIFMRSMLNNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGASLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0115104_1012001513300009677MarineMKFATLVALLGATQAITLWTTTGEIAYYAQDDDEEIAPDNMNIQLDDWHPGQHETLGASAYERVIPARFSTDDDDIFMRSMYKNYAIDKNCADKDDDPKPCGKFVMNESTMRAAASEVLCTHKGLCGAKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFIA
Ga0115104_1012570213300009677MarineNGMKFATLVCLIGASQAITLWTTKGEIAYFEADQDEEQEAMNIQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQATMRAAASEVLCTHKALCGGALQTYLDTYFQKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ*
Ga0115104_1037349313300009677MarineKILTIMKYTTLACLLGATQASITLWTTKGEIAYFEDDENTDAMNLQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQSTMRAAASEVLCTHKGLCGAKLGDYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ*
Ga0115104_1038682213300009677MarineMKFAIAALLGAVAARTTLYTTRGEIAYEEPEEMNLQVEDWHPGQHGTLGAGAYERVVPDRFSGDSDDIFMRSMINNYAIDKNCAGKDDPPAPCGKFVMNPVTMRAAASEVLCTHKGLCGPALENYLGTYFQKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLG*
Ga0115104_1044600513300009677MarineILTIMKFTTLAALLGVSQASITLWTTTGEIAYFQQDDDVADNMNVQLEDWIPGQHEMLGAAAYERVTPARFATDDDDIFMRSMIENYAIEKNCAEDPKKDDPIQCTPNKFVMNQATMNAAASEVLCTHKGLCGAALASYLDTYFAKAWGHFDVNRTGEVEVIKCPQFMRFLASDQYMSLQ
Ga0115104_1046119623300009677MarineMKFALAALLGYSYARTTLYTTMGEIAYVEDENAIQIDDFHPGLSGQMGAGAYERVTPARFSGDSDDIFMRSMINNYAIEKSEENKDTGKDVPTGKFVMNKVTMRAAAGEVLATHKGLSGDKLNSYLNTYFDKAWAHFDVNQSGEVEVIRCPQFMRFLASDQYMSLQ*
Ga0115104_1063152113300009677MarineLLNMKFAIVALLGLANARTTLYTTQGEIAYVEEDDQAALQIDDWHPGLSGQLGSGAYERVTPARFSGDSDDIFMRSMISNYAIDKNCAGKDEDPKPCGNFQMNKVTMRAAASEVLCTHKGLCGDKLNAYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ*
Ga0115104_1064678213300009677MarineKLLTKMKFTALAALIGATQAITLWTTHGEIAYFEADDEVSDEMNLQIDDWHPGQHEMLGAGAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCEEDDKKDPYPCGKFVMNAATMRAAASEVLCTHKGLCGASLQDYLGTYFEKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSL*
Ga0115104_1085878123300009677MarineLKMKFALAALLGLAQARTTLYTTMGEVAYVEEDESAALQIEDWHPGLSGQMGAGAYERVTPARFSADSDDIFMRSMVQNYAIDKDCAGKDEDPRPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ*
Ga0115104_1090884823300009677MarineGIILLKMKFAIAALLGLAAARTTLFTTQGQVAYVEEDNESAALQLDDWHPGQHETLGASAYERVTPERFSADSDDIFMRSMINNYAIEKNCAADPKKDDPVACGNFVMNKVTMRAAAGEVLATHKGLTGDKLNSYLATYFDKAFGHFDVNQTGEIEVMKTPQFMRFLASDQYMSLQ*
Ga0115104_1098431813300009677MarinePIHTMKFTAAACLLASAQAITLWTTNGEIAYSEMDEDEATNVQLNDWHAGQTGTLGNAEYERVVPSRFASDDDDIFMRSMVKNYAIEKGTKEEEDKPSVPTGKFIMNESTTRAAASEVLCTHKGLCGANLGKYLDTYFGKAWGHFDVNRTGEVEVIKMPQFMRFLASDQYMSLQ*
Ga0115104_1103612613300009677MarineKFAIAALLGAVSAKTTLYTTTGEIAYEEPEEMNLQINDWHPGQHGTLGGAAYERVIPARFSGDSDDIFMRSMLNNYAIDKNCAGKDDPPAPCGKFIMNKVTMRAAASEVLCTHKGLCGAALESYLGTYFDKAWGHFDVN*
Ga0115104_1109284613300009677MarineKFAIAALLGAVSAKTTVYTVTGEIAYEEPEEMVQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFIMNEATMRAAASEVLCTHKGLCGGSLQAYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0115104_1109393313300009677MarineMKFATLALIGAVSAKTTVYRTTGEVAYEEPEDLLQIDDWHPGQDGTLGGAEYSRVIPARFSADSDDIFMRSMLNNYAIDKNCAGKDDPPVPCGKFVMNEATMRAAASEVLCTHKGLCGGALTSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0115104_1110975413300009677MarineKVLTKMKFTLATACLLGYAQSITLWTIKGEIAYEEADQEEESMNVQIDDWHPGQHGTLGASEYTRVLPARFETDDDDIFMRSMYNNYAIEKDDAGKDEDPHPSGKFVMNESTMRAAASEVLCTHKGLCGAALGTYLDTYFAKAWGHFDVNRTGEIEVIKSP*
Ga0115104_1113092813300009677MarineMKFAIAALIGAVAARTTLYTTNGEIAYEEPEEMNLQVEDWHPGQHGTLGAGAYERVIPARFSGDSDDIFMRSMINNYAIDKNCAGKDDPPAPCGNFVMNPVTMRAAASEVLCTHKGLCGAALESYLGTYFQKSWGHFDVNQTGEIEVGKSPQFMRFLASDQYMSLQ*
Ga0115104_1116403313300009677MarineATLALLGAVSAKTTLYTVTGEIAYEEPEDMNLQIDDWHPGQSGTLGGAAYERVTPARFSADSDDIFMRSMIENYAVDKNCAGKDEDPVPCGKFVMNEVTMRAAASEVLCTHKGLCGDALQSYLGTYFSKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0115104_1118763423300009677MarineLKMKFALAALLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ*
Ga0115105_1098637213300009679MarineKILTIMKFTVLAALLGASQASITLWNTKGEIAYFEQDEDAEPMNVQLDDWHPGQHEMLGAAAYERVTPARFSTDSDDIFMRSMIQNYAIDKNCAGPDDPPAPCGKFTMNQVTMRAAASEVLCTHKGLCGGALQKYLDTYFAKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0115105_1102200413300009679MarineLLGLAQARTTLFTTMGEVAYVEEDNDSAALQIDDWHPGLSGQAGAGAYERVTPSRFSGDADDIFMRSMINNYAIDKNCAGKDEDPKPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKSWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0115105_1121128413300009679MarineSAITLFTTNGEVAYEESDSDDDEQAVQLNDWHPGQSGTLGKAEYKRVVTPRFSTDDDDIFMRSMIENYAIEDDGCPKSKDDDPDCVESPTGKFYMTEGTMRAAASEVLCTHKGLCGGALGKYLDTCFAKAWGHFDVNRGGKVEVIRSPQFMRFLASDQYMSLQ*
Ga0115105_1138287713300009679MarineMKTFALVALLSTASAITLWTTNGEIAYEESDDDEDQNVQLNDWHPGQSGTLGKSEYKRVVPARFASDDDDIFMRSMINNYAIEKANDDDEPTGKFVMNEATMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQA*
Ga0123368_105549513300009750MarineMKFTTLVCLLGASQAITLWTTRGEIAYFENDDDETEAMNIQLDDWHPGQHEMLGAAAYERVIPARFETDDDDIFMRSMYKNYAIDKNCADKDEDPRPCGKFVMNESTMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGKIPVMYAPQLMRFLLSDQYV
Ga0138316_1056409813300010981MarineKFATLALLGAVSAKTTLYTTSGEIAYEEPEEMNLQINDWHPGQHEMLGDSAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKKEDPVPCGKFVMNESTMRAAASEVLCTHKGLCGTALESYLGTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0138316_1096110113300010981MarineKFAILALLGAVSAKTTLYTTTGQIAYEEPEDLVQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFIMNEATMRAAASEVLCTHKGLCGASLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0138316_1137207213300010981MarineDDDEQAVQLNDWHPGQSGTLGKAEYKRVVTPRFSTDDDDIFMRSMIENYAIEDDGCPKSKDEEPDCVESPTGKFYMTEGTMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRGGKVEVIRSPQFMRFLASDQYMSLQ*
Ga0138316_1151128313300010981MarineELYFYKMKFAIAALIGAAAAKTTLWTTRGEIAYEEDDNETTNIMLDDWHPGQSGTLGAGEYERVTPARFAADSDDIFMRSMIQNYAIDKNCAGPDDPPKPCGKFTMNEVTMRAAASEVLCTHKGLCGGALQKYLDTYFTKAWGHFDVNKTGEIEVIKSPQFMRFLAS
Ga0138316_1166819913300010981MarineKMKFALAALLGLAQARTTLFTTMGEVAYVEEDNESAAVQIDDWHPGLSGQLGAGAYERVTPARFSADSDDIFMRSMIENYAIDKNCAGKKEDPVPCGNFQMNKVTMRAAASEVLCTHKGLCGDKLNSYLATYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ*
Ga0138323_1073775813300010984MarineELYFYKMKFAIAALIGAAAAKTTLWTTRGEIAYEEDDNETTNIMLDDWHPGQSGTLGAGEYERVTPARFAADSDDIFMRSMIQNYAIDKNCAGPDDPPKPCGKFTMNEVTMRAAASEVLCTHKGLCGGALQKYLDTYFTKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0138323_1146230013300010984MarineAYEEPEDLVQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFIMNEATMRAAASEVLCTHKGLCGASLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0138326_1014979413300010985MarineMKFTVAAALLLGTAQSITLWTTRGEIAYQEDDDEEAVALQLDDWHPGQHGTLGASEYERVIPARFSSDDDDIFMRSMIANYAIDKNCAGPDDPPKPCGKFTMNEATMRAAASEVLCTHKGLCGAALQTYLDTYFTKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYM
Ga0138326_1030472713300010985MarineELYFYKMKFAIAALIGAAAAKTTLWTTRGEIAYEEDDNETTNIMLDDWHPGQSGTLGAGEYERVTPARFAADSDDIFMRSMIQNYAIDKNCAGPDDPPKPCGKFTMNEVTMRAAASEVLCTHKGLCGGALQKYLDTYFTKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSL
Ga0138326_1057632113300010985MarineLTKMKFATLAALIGVSQAITLWTTTGEIAYYEQDEEEAGDAMNLQLDDWHPGQHETLGAAAYERVIPDRFSTDNDDIFMRSMYNNYAIEKNCAEKDDDPPVTCGKFVMNESTMRAAASEVLCTHKGLCGGKLGEYLDTYFAKAWGHFDVNRTGEVEIMKCPQFMRFLASDQYMSLQ*
Ga0138326_1085936013300010985MarineILTKMKFTIACLLAQTQAITLWTTTGEIAFYEDDNDVDGDYMNLQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCEEDDKKDPFPCGKFVMNEATMRAAASEVLCTHKGLCGAALGTYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0138326_1095990313300010985MarineKFALLAAAVSAKTTLYNLRGEIAYEEPEEANLQISDWLPGAHGTLGAGEYERVVPDRFSGDGDDIFMRSMINNYAVDKNCAGKKETPKPCGNFQMNETTMRAAASEVLCTHKGLCGDKLASYLDTYFAKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQSMSLGESG*
Ga0138326_1202626213300010985MarineKMKFALAALLGLAQARTTLFTTMGEVAYVEEDNESAAVQIDDWHPGLSGQLGAGAYERVTPARFSADSDDIFMRSMIENYAIDKNCAGKKEDPVPCGNFQMNKVTMRAAASEVLCTHKGLCGDKLNSYLATYFDKAWGHFDVNQTGEVEVGKSPQFMRFLASDQYMSLQ*
Ga0138324_1034703113300010987MarineTKMKFATLAALIGVSQAITLWTTTGEIAYYEQDEEEAGDAMNLQLDDWHPGQHETLGAAAYERVIPDRFSTDNDDIFMRSMYNNYAIEKNCAEKDDDPPVTCGKFVMNESTMRAAASEVLCTHKGLCGTALESYLGTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0138324_1044360013300010987MarineMKFAIAALLGVASAKTTLYTTTGEIAYEEPEDLLQLDDWHPGQHEMLGAAAYERVTPARFSADDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFIMNEATMRAAASEVLCTHKGLCGASLQSYLDTYFAKAWGHFDVNRVGEVEVSKMPQFMRFLASDQRMSLGENGF*
Ga0138324_1045227113300010987MarineMKYTLALAALLGLTHVEETSAITLFTTNGEVAYEESDSDDDEQAVQLNDWHPGQSGTLGKAEYKRVVTPRFSTDDDDIFMRSMIENYAIEDDGCPKSKDEEPDCVESPTGKFYMTEGTMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRGGKVEVIRSPQFMRFLASDQYMSLQ*
Ga0138324_1063191313300010987MarineMKFAILALLGVASTKTTVYTVTGEIAYEEPEDLVQLDDWHPGQHGTLGAGEYSRVTPARFSADSDDIFMRSMIENYAIDKNCAGKDDPPAPCGNFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0138324_1066849813300010987MarineIRMKFTTLACLLGATQAITIWTTRGEIAYFEAEDEDQEDTMNLQLDDWHPGQHETLGASAYERVIPARFSTDDDDIFMRSMYKNYAIDKNCAEEKEDPFPCGKFIMNESTMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSL
Ga0138324_1070248613300010987MarineMKFTVAAALLLGTAQSITLWTTRGEIAYQEDDDEEAVALQLDDWHPGQHGTLGASEYERVIPARFSSDDDDIFMRSMIANYAIDKNCAGPDDPPKPCGKFTMNEATMRAAASEVLCTHKGLCGAALQTYLDTYFTKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSL
Ga0138324_1071988613300010987MarineLMKFAIAALVGAVSARTVLYNNMGDVAFIQEDEDSSFLALDDFHPGQSGTLGGAAYARAIPDRFSADSDDIFMRSMYNNYAIEKQNEDTGAPTGKFVMNKSTTRAAASEVLCTHKGLCGAKLQSYLGTYFDKAWGHFDVNKTGEVEIMKTPQFMRFLASDQYMSLQ
Ga0163179_1037246813300012953SeawaterMKYTLALAALLGLTHVEETNAITVWTTRGEIAYEESESDDDETAIQLNDWHPGQSGTLGKAEYKRVVTPRFATDDDDIFMRSMIENYAIEKATEVKDGEKNADGTPKVEEPTGNFVMNEATMRAAASEVLCTHKGLCGGSLQKYLDTYFAKAWGHFDVNRSGEVEVIKSPQFMRFLASDQYMSLQ*
Ga0181431_113359913300017735SeawaterMTLTLKMSINRFIITLYYNLINGIKLLKMKFALAALLGLAQARTTLFTTMGEVAYVEEDNESAAIQIDDWHPGLSGQLGSGAYERVTPARFSGDADDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGT
Ga0187219_121996513300017751SeawaterENTDAMNLQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQSTMRAAASEVLCTHKGLCGAKLGDYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193133_101607013300018617MarineVAYEESDSDDDEQAVQLNDWHPGQSGTLGKAEYKRVVTPRFSTDDDDIFMRSMIENYAIEDDGCPKSKDDDPDCVESPTGKFYMTEGTMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0188862_101834223300018622Freshwater LakeKTLKMKFALVALLGLAQARTTLFTTMGEVAYVEEDESAAVQIDDWHPGQSGTLGAGTYERTTPARFSGDSDDIFMRSMISNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLATHKGLTGDKLNSYLGTYFDKAWGHFDVNQTGEIEVAKSPQFMRFLASDQYMSLQ
Ga0188862_101839423300018622Freshwater LakeIIMKFAILALLGVASTKTTLYTTSGEIAYEEPEDLVQLDDWHPGQHGTLGAAEYERVTPARFASDSDDIFMRSMIENYAIDKNCAGKDDPPAPCGNFVMNEATMRAAASEVLCTHKGLCGGSLQSYLGTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0188862_102255613300018622Freshwater LakeQAITLWTTTGQIAYFEADDQDTDAMNLQLDDWHPGQHGTLGASEYERVIPGRFSTDDDDIFMRSMYDNYAIDKNCAGKDDPPAPCGNFVMNQSTMRAAASEVLCTHKGLCGAALGTYLDTYFAKAWGHFDVNRTGEIEIIKSPQFMRFLASDQYMSLQ
Ga0193355_101579913300018628MarineMKFAILALVGAASARTTLYRTNGQIAYEEADDLNIQLDDWHPGQHGTLGAGAYEREVPARFSADSDDIFMRSMINNYAIDKNCAGPDDPPAPCGKFVMNASTMRAAASEVLCTHKALCGAALESYLGTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193355_102664913300018628MarineNTRGEIAYQTMDDDYVNLQVDDWHPGQSGTLGAGEYERVTPARFSADSDDIFMRSMINNYAIDKNCAGPDDPPAPCGKFTMNAVTMRAAASEVLCTHKALCGGELQKYLDTYFDKAWGHFDVNKSGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192944_103955213300018692MarineMKFALAALLGLAQARTTLFTTQGEVAYVEEDDVQAVQIDDWHPGLSGQMGAGSYERVTPARFSGDSDDIFMRSMISNYAIDKDCAGKGEDPRPCGNFVMNKVTMRAAAGEVLATHKGLTGDKLNSYLGTYFDKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193324_103593013300018716MarineLNMKYTLALAALLGLTHVEETSAITLFTTNGEVAYEESDSDDDEQAVQLNDWHPGQSGTLGKAEYKRVVTPRFSTDDDDIFMRSMIENYAIEDDGCPKSKDDDPDCVETPTGKFYMTEGTMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRGGKVEVIRSPQFMRFLASDQYMSLQ
Ga0192967_106517513300018730MarineFTTQGEVAYVEEDDVQAVQIDDWHPGLSGQMGAGSYERVTPARFSGDSDDIFMRSMIGNYAIDKNCAGKDEDARPCGNFVMNKVTMRAAAGEVLATHKGLTGDKLNSYLGTYFDKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193138_103602713300018742MarineMKFAILALLGAVSAKTTLYTTSGEIAYEEPEEMNLQINDWHPGQHEMLGASAYERVTPARFSADDDDIFMRSMIQNYAIDKNCEEDKKKDPYPCGKFVMNEATMRAAASEVLCTHKGLCGAALGSYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193138_104444913300018742MarineMKFAIIALLGVVSAKTTLYRTNGEIAYIEEEESNLQIDDWHPGQSGTLGAGEYARVTPARFSDDSDDIFMRSMIQNYAIDKNCSGPDDPPAPCGKFTMNQATMRAAASEVLCTHKGLCGAALTSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193138_105657013300018742MarineTTLFTTSGEVAYMQEDDDNVTLQLDDWHPGQSGTLGAGEYERVVTPRFSGDDDDIFMRSMIANYAIDKNCAGPDDPPAPWRAAASEVLATHKGLTGQALTTYLDTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193031_103676223300018765MarineTWGINGIIIIIMKFAILALLGVVSAKTTLYRTNGEVAFIEEDEQNIQINDWHPGQSGTLGAGEYERVVTARFAGDDDDIFMRSMIANYAIDKNCAGPDDPPAPCGKFTMNPATMRAAASEVLATHKGLTGQALTTYLDTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193031_104759413300018765MarineMGIINFNGIMKFTVAAALLIGYAQTITLWTTKGQIAYEESDDDEATNIQLDDWHPGQHGTLGASEYERVTPARFAGDDDDIFMRSMIQNYAIDKNCAGPDDPPVPCGKFTMNQATMTAAASEVLCTHKGLCGAALQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193031_104861213300018765MarineHGDNLINGIILTKMKFALAALLGVVSAKTTLFTTSGEVAYMQEDDDNVTLQLDDWHPGQSGTLGAGEYERVVTPRFSGDDDDIFMRSMIANYAIDKNCAGPDDAPKPCGKFTMNPVTMRAAASEVLATHKGLTGEALQKYLATYFEKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSL
Ga0193031_104992613300018765MarineMGNLINGIIIIMKYAVLALIGAAAAKTTLFRTTGEIAYEEDDELNLQINDWHPGQHEMLGANAYERVTPARFANDDDDIFMRSMIQNYAIEKNCTEDKDEPATTCGKFVMNPVTMRAAASEVLCTHKGLCGAGLQTYLGTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193031_105216813300018765MarineMGIINFNGIMKFTVAAALLIGYAQTITLWTTKGQIAYEESDDDEATNIQLDDWHPGQHGTLGASEYERVTPARFAGDDDDIFMRSMIQNYAIDKNCAGPDDPPVPCGKFTMNQATMTAAASEVLCTHKGLCGAALQSYLGTYFDKAWGHFDVNKSGEVEVMKSPQFMRFLASDQYMSLQ
Ga0193031_105528313300018765MarineITLFTTNGEVAYEESDSDDDEQAVQLNDWHPGQSGTLGKAEYKRVVTPRFSTDDDDIFMRSMIENYAIEDDGCPKSKDDDPDCVESPTGKFYMTEGTMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRGGKVEVIRSPQFMRFLASDQYMSLQ
Ga0193031_106252713300018765MarineWTVTGEIAYTEEEPESMNLQLNDWHPGQHEMLGADAYERVTPARFSTDDDDIFMRSMIQNYAIEKNCTEDKDDPPTTCGKFVMNEATMRAAASEVLATHKGLTGGKLQEYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193031_106263813300018765MarineWTTTGEIAYQEDDEPEAMNVQIDDWHPGQHGTLGASEYTRVVPARFSTDDDDIFMRSMIANYAIEKNCSGPDDPPTTCGKFVMNEATMRAAASEVLCTHKGLCGAALQTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193031_106365413300018765MarineWTVTGEIAYTEEEPESMNLQLNDWHPGQHEMLGADAYERVTPARFSTDDDDIFMRSMIQNYAIEKNCTEDKDDPPTTCGKFVMNEATMRAAASEVLATHKGLTGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQXAVLRPEYVGVNE
Ga0193031_108166713300018765MarineIDDWHPGLSGQLGAGSYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKAWGHFDVNQTGEVEVGKSPQFMRFLASDQYMSLQ
Ga0193149_104309513300018779MarineKFAIVALIGLVSARTTLFRTNGEIAYEEEDQSNLMLDDWHPGQSGTLGAGEYERVVPARFSSDDDDIFMRSMIGNYAIDKNCAGKDDPPVPCGKFVMNAATMRAAASEVLCTHKGLCGGALTTYLDTYFDKAWGHFDVNKTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193149_104408513300018779MarineMKFAALIGLVSARTVLYNNQGDVIFAELNDEEMNLELDDFHPGQSGTLGGASYERVTPAHFSGDGDDIFMRSMIQNYAMEKADDDGKPTGALVMNASTARAAASEVLCTHKKLCGAKLTKYLGTYFDKAFGHFDVNKTGEFEVIKSPQFMRFLASDQYMSLQ
Ga0193149_104774113300018779MarineTIWTTNGQIAYQEEEEEAMNVQLDDWHPGQHGTLGASEYERVVPARFSTDDDDIFMRSMITNYAIDKNCAGPDDPPVPCGKFVMNQATMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193149_104789313300018779MarineMKFAVLVAAAAARTTLWTTTGQIAYMEEDDNNNLQIDDWHPGQSGTLGAGEYERVIPGRFSADSDDIFMRSMIENYAIDKNCADKDDDPKPCGKFTMNPVTMRAAASEVLCTHKGLCGASLQKYLATYFDKAWGHFDVNKSGEVEVLKAPQFMRFLASDQYMSLQ
Ga0193149_105336413300018779MarineMKFAVLVAAAAARTTLWTTTGQIAYMEEDDNNNLQIDDWHPGQSGTLGAGEYERVIPGRFSADSDDIFMRSMIENYAIDKNCADKDDDPKPCGKFTMNPVTMRAAASEVLCTHKGLCGASLQAYLGTYFDKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192950_106011513300018791MarineDWHPGQHGTLGGSEYERVIPDRFSTDSDDIFMRSMYNNYAIDKNCAGADEDPMPCGKFVMNESTMRAAASEVLCTHKGLCGGKLGEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193117_105473713300018796MarineKFTVAAALLLGTAQSITLWTTRGEIAYQEDDDEEAVALQLDDWHPGQHGTLGASEYERVIPARFSSDDDDIFMRSMIANYAIDKNCAGPDDPPKPCGKFTMNEATMRAAASEVLCTHKGLCGAALQTYLDTYFTKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193475_104020123300018855MarineIGATQAITLWTTHGEIAYFEADDEVSDEMNLQIDDWHPGQHEMLGAGAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCEEDDKKDPYPCGKFVMNAATMRAAASEVLCTHKGLCGASLATYLDTYFEKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193475_104289213300018855MarineMGNLINGITLKMKFALAALLGLAQARTTLFTTSGEVAYVEDDESAALQIDDWHPGLSGQLGSGAYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAFGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193308_105819613300018862MarineTMKFALLAFLGAVNATVVYTVNGEVAYDGDADDMNVQLDDWHPGQHEMLGAAAYERVIPARFETDDDDIFMRSMIKNYAIEKNCAEDPEKDPAIQCTPNKFVMNEATMRAAASEVLCTHKGLCGASLATSLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0192978_106100913300018871MarineLTDQPLNTMKFTALALCLASTQAITLWTTTGEIAYEENDEEETNVQLSDWHAGQAGTLGNAEYARVVTPRFAADDDDIFMRSMIKNYAIEKATDDKENPVPTGKFIMNEATMRAAASEVLCTHKGLCGAALQGYMNSYYGKAWGHFDVNKTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0192978_106464413300018871MarineNGIILIPKMKFAIAAFLGLAAARTTLYTTTGDIAFEQEDDDNMSLQLDDWHPGQSGTLGGAEYSRVTTARFSADDDDIFMRSMIQNFAIEKNSGGDGPAVASGKFVMNAITMRAAAAEVLATHKGLTGDKLSAYLTTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASD
Ga0192978_107868713300018871MarineEIMKFALALIAAVTAHKVNDWHPGQHGTLGASDYERVIPARFSSDDDDIFMRSMIKSYAIDKNCAGPDDPPATCGKFVMNESTMRAAASEVLCTHKGLCGGKLQEYLDTYFAKSWGHFDVNRTGEIEVIKSPQFMRFIASDQYMSLQ
Ga0192868_1003469013300018913MarineHGNLINGIILLKMKFALAAFLGLAQARTTLFTTQGEVAYVEDDESAALQIDDWHPGLSGQLGSGAYERVTPARFSGDADDIFMRSMINNYAIDKNCAGKDEDPKPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAFGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0192868_1004533813300018913MarineLAQARTTLFTTMGEVAYIEEDEATAVQIEDWHPGLSGQLGAGSYERVTPAGFSGDADDIFMRSMINNYAIDKDCAGKGEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKAFGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0192868_1005401713300018913MarineMGIIKFNGIIMKFAIAALLGAVSAKTTLYTTTGEVAYEEPEEMVQLDDWHPGQHEMLGAAAYERVTPARFSADDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFIMNEATMRAAASEVLCTHKGLCGGALQTYLDTYFSKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193260_1007468823300018928MarineKNLTKMKFTVAAALLGCAQSMTIWSTHGEILYSEVEEEGELLQLNDWHPGQSGTLGAGEYARVTPARFASDDDDIFMRSMIENYAIDKNCAGKDDPPAPCGKFTMNQATMRAAASEVLCTHKGICGAALGTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193260_1007845413300018928MarineIIIIMKFAIIALLGVVSAKTTLYRTNGEIAYIEEEESNLQIDDWHPGQSGTLGAGEYSRVTPARFASDDDDIFMRSMIENYAIDKNCAGKDDPPAPCGKFTMNQATMRAAASEVLCTHKGLCGAALTSYLDTYFAKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193260_1008996723300018928MarineIILYKMKFAIAALLGVVSARTTLFTTSGEVAFMQEDDDNLNLQLDDWHPGQSGTLGAGEYSRVTPARFSADSDDIFMRSMIENYAIDKNCAGKDDPPAPCGKFTMNPVTMRAAASEVLCTHKGLCGGQLQTYLGTYFDKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193260_1009683813300018928MarineGIMKFTIAAALLLGYAQTITLWTTAGEIAYEESDDDEETNVQLEDWHPGQHGTLGAGEYERVIPARFSSDDDDIFMRSMIGNYAIDKNCAGKDDPPAPCGKFTMNEATMRAAASEVLCTHKGLCGASLQTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASD
Ga0193552_1017520413300018934MarineKTTLFSTNGEIAYVEDEEAVQLGDWHPGQSGTLGAGEYARVVPDRFSADSDDIFMRSMIANYAIDKNCAGKDDPPAPCGKFVMNEATMRAAASEVLCTHKGLCGAALQTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193178_1004871413300018967MarineLAQARTTLFTTMGEVAYVEEDESAALQIEDWHPGLSGQLGAGSYERVTPARFSGDSDDIFMRSMINNYAIDKDCAGKGEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193178_1007772413300018967MarineLAQARTTLFTTMGEVAYVEEDESAALQIEDWHPGLSGQLGAGSYERVTPARFSGDSDDIFMRSMINNYAIDKDCAGKGEDPRPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0192894_1017869423300018968MarineMKFAIVALLGAASARTTLFTTTGEIAFMQEDDDNLNLQIDDWHPGQSGTLGAGEYARVTPARFSADSDDIFMRSMIQNYAIDKNCAGKDDPPAPCGKFTMNPVTMRAAASEVLCTHKGLCGESLQKYLGTYFDKSWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192894_1022396513300018968MarineMKFTIAMAAFLGYTQAITLWTTNGEIAYEESDDDDDTNVQVGEWHPGQSGSLGAAEYERVITPRFSADSDDIFMRSMIKNYAIEKSQCDLDDDCKDHPEKNVPTGVFVMTEGTTRAAASEVLCTHKGLCGAALGNYMNTYFAKAWGHFDVNRTGAVEVIKMPQLMRFLSSDQYMSLQ
Ga0192894_1022564713300018968MarineLWTTRGEIAYEESESEDDTNVQLNDWHAGQAGTLGNAEYERVVTPRFAADDDDIFMRSMIKNYAIEKATDDDKPVPTGKFIMNEATMRAAASEVLCTHKSLCGAGLQKYLDTYFGKAWGHFDVNKTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0192894_1026392513300018968MarineVEETNAITIWTTRGEIAYEESESDDDETQLQLNDWHPGQSGTLGKAEYKRVITPRFSSDDDDIFMRSMIENYAIEKATECKDGEKMADGTDCVELPTGKFVMNEATMRAAASEVLCTHKGLCGGALGKYLDTYFSKAWGHFDVNRSGDVEVIKSPQFMRFLASDQYMSLQ
Ga0192873_1037708913300018974MarineEVAYVEEDNESAAVQIDDWHPGLSGQLGAGSYERVTPARFSGDSDDIFMRSMISNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQSGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193353_1015859823300018977MarineHVEETSAITLFTTNGEVAYEESDSDDDEQAVQLNDWHPGQSGTLGKAEYKRVVTPRFSTDDDDIFMRSMIENYAIEDDGCPKSKDDDPDCVESPTGKFYMTEGTMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRGGKVEVIRSPQFMRFLASDQYMSLQ
Ga0193353_1017228213300018977MarineLGEIAYQVEDDDTALQIDDWHPGQSGTLGAGEYARVTPARFSDDSDDIFMRSMIQNYAIDKNCAGPDDPPAPCGKFTMNEATMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRVGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193353_1018325613300018977MarineESDDDNEAIQISDWHPGQSGTLGKAEYKRVITPRFSSDDDDIFMRSMIENYAIEKSTECKDDEKMPDGSPCVELPTGKFVMNEATMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0192961_1019332913300018980MarineEIAYEQNDDLVQIDDWHPGLSGQLGAGEYSRVTPARFATDDDDIFMRSMINNYAIETEDADKNPSGKFIMNESTMRAAASEVLCTHKGLCGGSLQAYLDTYFAKAWGHFDVNRTGSVEVIKCPQFMRFLASDQYMSLQ
Ga0192961_1025807313300018980MarineVQIDDWHPGLSGQLGAGSYARVTPERFSGDSDDIFMRSMINNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKSWGHFDVNQTGEIEVGKSPQFMRFLASDQYMSLQ
Ga0192947_1013588313300018982MarineMKFTTLAALLGVSQASITLWTTTGEIAYFQXXXXQQDDDVPDNMNLQIEDWIPGQHEMLGAAAYERVTPANFATDDDDIFMRSMIENYAIEKNCAEDVKKDDPVQCTPNKFVMNSATMTAAASEVLCTHKGLCGAALGAYLDTYFAKAWGHFDVNRTGEVEVIKCPQFMRFLASDQYMSL
Ga0192947_1015126013300018982MarineMKFATLAALIGVSQAITLWTTTGEIAYYEQDEEEAGDAMNLQLDDWHPGQHGTLGGSEYERVIPDRFSTDSDDIFMRSMYNNYAIDKNCAGADEDPMPCGKFVMNESTMRAAASEVLCTHKGLCGGKLGEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192947_1017839213300018982MarineMGNLINGIILLKMKFAIAALLGLAAARTTLFTTQGQVAYVEEDNESAALQLDDWHPGQHETLGASAYERVTPERFSGDSDDIFMRSMIQNYAIEKNCAAPKADPVACGNFVMNKVTMRAAAGEVLATHKGLTGDKLQSYLATYFDKSFGHFDVNQTGEIEVMKAPQFMRFLASDQYMSLQ
Ga0192947_1017927213300018982MarineMGIINFNGIIMKFAILALLGVASTKTTLYTTNGNIAYEEPEDLLQLDDWHPGQHEMLGASAYERVTPARFSADSDDIFMRSMIQNYAIDKNCAGKDDDPAPCGKFVMNEATMRAAASEVLCTHKGLCGASLGSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192947_1027698613300018982MarineMGIIKFNGIIMKFAILAAAVAAKTTLYTTRGEIAYEEPEDLLQLDDWHPGQHEMLGAAAYERVTPARFSADEDDIFMRSMIQNYAIEKNCAADIKKDDPIACGNFIMNASTMRAAASEVLCTHKGLCGGALNTYLGTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193275_1024209013300018988MarineYEENDEPELLQLDDWHPGQHGTLGASEYERVVPARFSTDDDDIFMRSMITNYAIDKNCAGKDEPPVPCGKFVMNEATMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1013109413300018989MarineMKFTTLALLAASAEAITLWTTKGQIAYYEDDDETESMNVQLDDWHPGQHGTLGGAAYERVYPARFQTDDDDIFMRSMYENYAIDKNCAGKDDPPAPCGKFVMNEATMRAAASEVLCTHKGLCGASLQTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1014241913300018989MarineMKFALFALLGYASARTTLYNYQGQITYMTEDDDVNLQLDDWHPGQSGTLGAGEYERVIPARFSADSDDIFMRSMIANYAIDKNCAADKDDPPITCGKFTMNPVTMRAAASEVLCTHKGLCGAQLQTYLDTYFQKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1014615213300018989MarineMKYTLALAALLGLTHVEETSAITLFTTNGEVAYEESDSDDDEQAVQLNDWHPGQSGTLGKAEYKRVVTPRFSTDDDDIFMRSMIENYAIEDDGCPKSKDDDPDCVESPTGKFYMTEGTMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRGGKVEVIRSPQFMRFLASDQYMSLQ
Ga0193030_1014667923300018989MarineMKFAIAALLGAVAARTTLYTTRGEIAYEEPEEMNLQVEDWHPGQHGTLGAGAYERVVPDRFSGDSDDIFMRSMINNYAIDKNCAGKDDPPAPCGKFVMNPVTMRAAASEVLCTHKGLCGPALENYLGTYFQKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1014894313300018989MarineMKYTLALAALLGLTHVEETNAITVWTTRGEIAYEESESDDDETAIQLNDWHPGQSGTLGKAEYKRIVTPRFATDDDDIFMRSMIENYAIEKATEVKDGEKNADGTPKVEEPTGNFVMNEATMRAAASEVLCTHKGLCGGTLQKYLDTYFAKAWGHFDVNRSGEVEVIKCPQFMRFLASDQYMSLQ
Ga0193030_1015348313300018989MarineMKIAIACLLASTQAITLWTTNGEIAYYSNDDEDLEPMNVQLDDWSPGQHEMLGAAAYERVTPARFATDDDDIFMRSMIENYAIEKNCAEDVKKDDPIQCTPNKFVMNQATMTAAASEVLCTHKGLCGGALQSYLDTYFAKAWGHFDVNRTGEVEVIKCPQFMRFLASDQYMSLQ
Ga0193030_1016036813300018989MarineMGYNLINGIILTKMKFALAALLGVVSAKTTLFTTSGEVAYMQEDDDNVTLQLDDWHPGQSGTLGAGEYERVVTPRFSGDDDDIFMRSMIANYAIDKNCAGPDDAPKPCGKFTMNPVTMRAAASEVLATHKGLTGEALQKYLATYFEKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSL
Ga0193030_1016319913300018989MarineMGNLINGIIIIIMKFAILALLGVVSAKTTLYRTNGEVAFIEEDEQNIQINDWHPGQSGTLGAGEYERVVTARFAGDDDDIFMRSMIANYAIDKNCAGPDDPPAPCGKFTMNPATMRAAASEVLATHKGLTGQALTTYLDTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1016328813300018989MarineMKFAVLALVGAVSARTTLWTTRGEIAYMEEDEENNLQIDDWHPGQSGTLGAGEYERATPARFSADSDDIFMRSMIQNYAIDKNCAGPDDPPKPCGKFTMNPVTMRAAASEVLCTHKGLCGAALQTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1017453223300018989MarineMKFAIVALLGAAAAKTTLYTVTGQVAYEEPEEMNLQIEDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCADKDDDPRPCGKFIMNAATMRAAASEVLCTHKGLCGKALEDYLGTYFEKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1017595313300018989MarineMKFAVLALVGAVSARTTLWTTRGEIAYMEEDEENNLQIDDWHPGQSGTLGAGEYERATPARFSADSDDIFMRSMIQNYAIDKNCAGPDDPPKPCGKFTMNPVTMRAAASEVLCTHKGLCGAALQSYLGTYFDKAWGHFDVNKSGEVEVMKSPQFMRFLASDQYMSLQ
Ga0193030_1017905213300018989MarineMKFALFALLGYASARTTLYNYQGQITYMTEDDDVNLQLDDWHPGQSGTLGAGEYARETPARFSADSDDIFMRSMIQNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKAWGHFDVNQTGEVEVGKSPQFMRFLASDQYMSLQ
Ga0193030_1018123613300018989MarineMKFAIAALLGLAQARTTLFTTQGEVAYVEEDDNSMIQTEDWHPGQHETLGASAYERTVPANFSGDGDDIFMRSMINNYAIEKNCAADPKKDDPVQCGKFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKSWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1018134413300018989MarineMKFAVLALVGAVSARTTLWTTRGEIAYMEEDEENNLQIDDWHPGQSGTLGAGEYERATPARFSADSDDIFMRSMIQNYAIDKNCAGPDDPPKPCGKFTMNPVTMRAAASEVLCTHKGLCGAALQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1018280613300018989MarineMKFATLAALLGATQAITLWTTTGQIAYYENDDDMPDAMNLQIDDWHPGQHGTLGGSEYTRVIPARFTSDDDDIFMRSMLNNYAIEKEDDDEKPSGKFIMNQSTMRAAASEVLCTHKGLCGGKLNEYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1018352913300018989MarineHGDNLINGIILLKMKFALVALLGLAQARTTLYTTTGQVAYVEEDESAAVQIDDWHPGLSGQLGAGSYERVTPARFSADSDDIFMRSMISNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKSWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1018461113300018989MarineMGNLINGIILLKMKFALAALLGLAQARTTLFTTQGEVAYVEDDESTAVQVDDWHPGLSGQLGAGSYERVTPARFSGDADDIFMRSMIQNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKAWGHFDVNQTGEVEVGKSPQFMRFLASDQYMSLQ
Ga0193030_1018471213300018989MarineMKFTVAVAALLGYAQARTTLFTTSGEIAYQQEDDESLNLQIDDWHPGQSGTLGAGEYARVTPARFASDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGALQSYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1018868513300018989MarineMGIIKKIIKMKFAILALLGYASAKTTLWTVGGDIAYEEEEESNLQIDDWHPGQSGTLGGGAYERVITARFATDDDDIFMRSMIENYAIDKNCAGKDDPPVPCGKFVMNEATMRAAASEVLCTHKGLCGAKLQDYLNTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1019527313300018989MarineFTVAAALLIGYAQTITLWTTKGQIAYEESDDDEATNIQLDDWHPGQHGTLGASEYERVTPARFAGDDDDIFMRSMIQNYAIDKNCAGPDDPPVPCGKFVMNQATMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1019588913300018989MarineMKFAIACLLGATNAITLWTVTGEIAYTEEEPESMNLQLNDWHPGQHEMLGADAYERVTPARFSTDDDDIFMRSMIQNYAIEKNCTEDKDDPPTTCGKFVMNEATMRAAASEVLATHKGLTGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1019655013300018989MarineMGIINFNGIIMKFAILALLGVVSAKTTLYRTNGEIAYEEAEESNLQIDDWHPGQSGTLGAGEYARVTPARFASDDDDIFMRSMIQNYAIDKNCEEDKKKDPYPCGKFVMNEATMRAAASEVLCTHKGLCGAALGSYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1021718313300018989MarineTVTGEIAYTEEEPESMNIQLDDWHPGQHEMLGAAAYERVTPARFASDDDDIFMRSMIQNYAIEKNCAEDVEKDPAVTCGKFVMNEATMRAAASEVLCTHKGLCGGGLQTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1023779713300018989MarineMKYTLALAALLGLTHVEETNAITVWTTRGEIAYEESESDDDETAIQLNDWHPGQSGTLGKAEYKRIVTPRFATDDDDIFMRSMIENYAIEKATEVKDGEKNADGTPKVEEPTGNFVMNEATMRAAASEVLCTHKGLCGASLQKYLDTYFAKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMS
Ga0193030_1025223113300018989MarineEQNIQIDDWHPGQSGTLGAGEYKRETPARFSADDDDIFMRSMINNYAIDKNCAGKDDPPAPCGKFVMNEATMRAAASEVLCTHKALCGAALGSYLDTYFQKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1025302113300018989MarineMNVQLDDWHPGQHEMLGAAAYERVTPARFSADDDDIFMRSMIQNYAIDKNCESDKDKPAFPCGKFVMNEATMRAAASEVLCTHKGLCGGALGTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1025433613300018989MarineDDWHPGQSGTLGAGEYARVVPARFAADDDDIFMRSMIANYAIDKNCAGPDDPPAPCGKFTMNPVTMRAAASEVLCTHKGLCGGALQTYLGTYFDKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1025435223300018989MarineVAYVEEDDTQNLQIEDWHPGQHEMMGAGAYERVTPDRFSADADDIFMRSMIQNYAIDKNCAGKDDPPKPCGKFIMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1027310423300018989MarineSAALQIDDWHPGLSGQLGSGAYERVTPARFSGDSDDIFMRSMISNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKSWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193030_1028995313300018989MarineDWHPGLSGQLGSGAYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAFGHFDVNQTGEVEVTKSPQFMRFLASDQYMSLQ
Ga0193030_1028996913300018989MarineDWHPGLSGQLGSGAYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKAWGHFDVNQTGEVEVGKSPQFMRFLASDQYMSLQ
Ga0193030_1029005413300018989MarineMKFTLLALLGVAQARTTLYRTTGEIAFVEEDESNIQLDDWHPGQHGTLGAGEYTRVVPARFANDDDDIFMRSMIANYAIEKNCSGPDDPPTTCGKFTMNPATMRAAASEVLCTHKGLCGGSLATYLDTYFDKAWGHFDVNKTGEVEVIKSPQFMRFLASDQY
Ga0193030_1029837613300018989MarineMKFTALAALIGATQAITLWTTTGQIAYFENDDEPEAMNVQLDDWHPGQHEMLGASAYERVMPARFETDDDDIFMRSMIKNYAIDKNCEEDEDKDPYPCGKFVMNESTMRAAASEVLCTHKGLCGGNLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRF
Ga0193034_1011752613300019001MarineIAYEEPEDLLQLDDWHPGQHEMLGAAAYERVTPARFSADSDDIFMRSMIQNYAIDKNCAGKDDPPAPCGKFTMNPVTMRAAASEVLCTHKGLCGGALQKYLGTYFEKAWGHFDVNKSGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193034_1012994513300019001MarineEEPEEMNLQINDWHPGQHEMLGAAAYERVTPARFATDDDDIFMRSMIQNYAIEKNCAADPKKDDPVSCGKFVMNEVTMRAAASEVLCTHKGLCGAALQSYLGTYFAKAWGHFDVNRTGEVEVIKSP
Ga0193034_1013457013300019001MarineQIDDWHPGQSGSLGIAYERVTPARFSADSDDIFMRSMIQNYAIDKNCAGKDDPPAPCGKFTMNPVTMRAAASEVLCTHKGLCGGALQKYLGTYFEKAWGHFDVNKSGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193044_1020007013300019010MarineMGINFNGIIMKFAILALLGVASTKTTLYTTRGEIAYEEPEDLVQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGSLQAYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193044_1022967113300019010MarineAAVQIDDWHPGLSGQLGAGSYERVTPARFSGDSDDIFMRSMISNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKSWGHFDVNQTGEIEVGKSPQFMRFLASDQYMSLQ
Ga0192982_1031304923300019021MarineEANDDLVQIEDWHPGQSGTLGNAEYARVTPARFSTDDDDIFMRSMIQNYAIDKNCSGPDDAPTTCGKFTMNQATMRAAASEVLSTHKGLAGAALGTYLDTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASD
Ga0192951_1016398513300019022MarineHGELLLTDLIILTKMKFATLAALIGVSQAITLWTTTGEIAYYEQDEEEAGDAMNLQLDDWHPGQHGTLGGSEYERVIPDRFSTDSDDIFMRSMYNNYAIDKNCAGADEDPMPCGKFVMNESTMRAAASEVLCTHKGLCGGKLGEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193535_1025727813300019024MarineLLGATNAITLWTVTGEIAYTEEEPESMNLQLNDWHPGQHEMLGADAYERVTPARFSTDDDDIFMRSMIQNYAIEKNCTEDKDDPPTTCGKFVMNEATMRAAASEVLATHKGLTGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192909_1023112023300019027MarineHGAVIQIDDWHPGLSGQMGAGAYERVTPARFSADSDDIFMRSMVQNYAIDKNCAGKDEDPKPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKSWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193516_1015895713300019031MarineMKFAILALIGAASARTTLWTTTGQIAFMEEDDENNLQIDDWHPGQSGTLGAGEYARVTPDRFSADSDDIFMRSMIQNYAIDKNCAGPDDPPKPCGKFTMNPVTMRAAASEVLCTHKGLCGASLQKYLGTYFDKAWGHFDVNKSGEIEVLKSPQFMRFLASDQYMSLQ
Ga0193516_1016929713300019031MarineMGNYFLTELYFLTKMKFTIAAALLLGYAQSITLWTTTGEIAYEESDDDEATNVQLDDWHPGQHGTLGASEYTRVTPARFATDDDDIFMRSMIENYAIEKNCSGPDDPPTTCGKFVMNEATMRAASSEVLCTHKGLCGGKLQEYLDTYFNKAWGHFDVNRVGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193516_1018633713300019031MarineMKFTIALAAFLGMAQAKTTLWTTLGQIAYEEDDEDTNIQIDDWHPGQSGTLGAGEYERVTPTRFSADSDDIFMRSMIQNYAIDKNCAGKDDPPAPCGKFTMNQVTMRAAASEVLCTHKGLCGGALQKYLDTYFAKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193516_1023491313300019031MarineEEDDEPETMNIQLDDWHPGQHGTLGASEYTRVVPARFSTDDDDIFMRSMIANYAIEKNCSGPDDPPTTCGKFVMNEATMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193516_1024510413300019031MarineYEEDEESNLQIDDWHPGQSGTLGGGAYERVITPRFATDDDDIFMRSMIENYAIDKNCAGKDDPPAPCGKFVMNEATMRAAASEVLCTHKGLCGAKLQDYLNTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193516_1025484113300019031MarineEEADEEDTNVQIDDWHPGQSGTLGGSEYSRVTPARFSSDSDDIFMRSMINNYAIEAENDDGAPSGNFYMTEATMRAAASEVLCTHKGLCGAALGKYLGTYFAKAWGHFDVNKGGKVEVIRSPQFMRFLASDQYMSLQ
Ga0192869_1025184823300019032MarineMGIFLTELKFLTIMKYTLATACLLGYAQSITLWTTTGQIAYYENDDMEEDNMNLQIEDWHPGQHETLGASAYERVIPDRFSADSDDIFMRSMYNNYAIDKNCAGKKEDPRPCGKFVMNEATMRAAASEVLCTHKGLCGAALGTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192869_1026548423300019032MarineMKFALAALLGLAQARTTLFTTFGEVAYVEDDESSALQIDDWHPGLSGQLGAGAYERVIPARFSADSDDIFMRSMLENYAIDKNCAGKDDDPVPCGKFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192869_1026607913300019032MarineMNLQLDDWHPGQHETLGASAYERVIPARFTSDDDDIFMRSMYKNYAIDKNCAGKDEPPVPCGKFIMNESTMRAAASEVLCTHKGLCGGKLVEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192869_1027267413300019032MarineMGNLINGIKLLKMKFALAALLGLAQARTTLFTTMGEVAYVEEDNESAAVQIDDWHPGLSGQLGAGSYERVTPARFSGDSDDIFMRSMISNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKSWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192869_1027489413300019032MarineMGNLINGIILLKMKFAIAALLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGSYERVTPARFSADSDDIFMRSMISNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYYDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0192869_1027515413300019032MarineTWGINFNGIIMKFAILALVGAVSAKTTLYTTRGEVAYEEPEDLLQLDDWHPGQHGTLGGAEYTRVIPARFTADEDDIFMRSMLNNYAIEKEDDDEKPSGKFIMNQSTMRAAASEVLCTHKGLCGASLEAYLGTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192869_1027795713300019032MarineHGNLINGITIKMKFALAALLGLAQARTTLFTTMGEVAYIEEDEATAVQIEDWHPGLSGQLGAGSYERVTPARFSGDADDIFMRSMINNYAIDKDCAGKGEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKSWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192869_1029618213300019032MarineMGIINFNGITMKFAIVALLGVASAKTTLYTTRGEVAYEEPEEMVQLDDWHPGQHEMLGAAAYERVTPARFSADDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFIMNEATMRAAASEVLCTHKGLCGGALQTYLDTYFSKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192869_1029619013300019032MarineMGIIKFNGIIMKFAIAALLGAVAAKTTLYTTSGEIAYEEPEEMVQLDDWHPGQHEMLGAAAYERVTPARFSADDDDIFMRSMIQNYAIDKNCAGKDDDPAPCGKFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192869_1029697613300019032MarineHGIIKFNGIIMKFAILALLGVASAKTTVYTVTGEIAYEEPEDLLQLDDWHPGQHEMLGAAEYSRVTPARFASDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192869_1036332713300019032MarineIAYFQQDDDVADNMNVQIEDWIPGQHEMLGASAYERVTPARFASDDDDIFMRSMIENYAIEKNCAEDPKKDPPIQCTPNKFVMNAATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192869_1036465013300019032MarineMGNLINGIITLKMKFAIVALLGLAQARTTLFTTTGQVAYVEEDNESAALQLEDWHPGQHETLGASAYERVTPANFAGDADDIFMRSMIQNYAIEKNCAKDPKKDDPISCGKFVMNKVTMRAAAGEVLATHKGLSGDKLNSYLGTYFDKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192869_1042441513300019032MarineIQLDDWHPCQHGTLGASEYTRVVPARFSTDDDDIFMRSMIANYAIEKNCSGPDDPPTTCGKFVMNEATMRAASSEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRVGEVEVIKSPQFMRFLASDQYMSLQ
Ga0192869_1044386113300019032MarineEEMNLQINDWHPGQSGTLGAGNYERVTPARFSADSDDISMRSMINNYAIDKDCAGKDEDPRPCGNFVMNEVTMRAAASEVLCTHKGLCGKSLEDYLGTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0192869_1045913913300019032MarineWTTSGEIAYYENEDEEPASDMNIQLDDWHPGQHETLGASAYERVIPARFSTDDDDIFMRSMYKNYAIDKNCAGKDEDPFPCGKFIMNESTMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEVEVIKSP
Ga0193037_1020188313300019033MarineTLWTTTSEIAYEEDDEPEAMNIQLDDWHPGQHGTLGAAEYVRVVPARFAGDDDDIFMRSMINNYAIDKNCAGKDDPPAPCGKFTMNEATMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193037_1023465513300019033MarineWTTTGQIAFMEEDDENNLQIDDWHPGQSGTLGAGEYARVTPDRFSADSDDIFMRSMIQNYAIDKNCAGPDDPPKPCGKFTMNPVTMRAAASEVLCTHKGLCGASLQKYLGTYFDKAWGHFDVNKSGEIEVLKSPQFMRFLASDQYMSLQ
Ga0193037_1024850213300019033MarineMQTDDDDVNLQVDDRHPGQTGTLGAGEYERVVTPRFSADNDDIFMRSMISNYAIDKNCSGPDDPPAPCGKFTMNPATTRAAASEVLCTHKGLCGAKLQAYLGTYFDKAWGHFDVNKTGEIEVIKTPQFMRFLASDQYMSLQ
Ga0193037_1026094613300019033MarineDWHPGQHGTLGAAEYVRVVPARFAGDDDDIFMRSMINNYAIDKNCAGKDDPPAPCGKFTMNEATMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192945_1027436913300019036MarineHGIINFNGIIMKFAILAAAVAAKTTLYTTRGEIAYEEPEDLLQLDDWHPGQHEMLGAAAYERVTPARFSADEDDIFMRSMIQNYAIEKNCAADIKKDDPIACGNFIMNASTMRAAASEVLCTHKGLCGGALNTYLGTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192886_1030234123300019037MarineDDWHPGQSGTLGAGEYARVTPDRFSADSDDIFMRSMIQNFAIDKNCAGPDDPPAPCGKFTMNPVTTRAAASEVLCTHKGLCGDKLQAYLGTYFDKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193123_1040994123300019039MarineQIEDWHPGQHEMLGAGAYERVTPDRFSADADDIFMRSMIQNYAIDKNCAGKDDPPKPCGKFVMNKVTMRAAASEVLATHKGLTGDKLNSYLGTYFDKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193336_1027030213300019045MarineMKYTLALAALLXLTHVEETNAITVWTTRGEIAYEESESDDDETAIQLNDWHPGQSGTLGKAEYKRVVTPRFATDDDDIFMRSMIENYAIEKATEVKDGEKNPDGTPKVEEPTGNFVMNEATMRAAASEVLCTHKGLCGGTLQKYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQXAANL
Ga0193336_1027035313300019045MarineTWGYLITKMKYTLALAALLXLTHVEETNAITVWTTRGEIAYEESESDDDETAIQLNDWHPGQSGTLGKAEYKRVVTPRFATDDDDIFMRSMIENYAIEKATEVKDGEKNPDGTPKVEEPTGNFVMNEATMRAAASEVLCTHKGLCGGTLQKYLDTYFAKAWGHFDVNRSGEVEVIKCPQFMRFLASDQYMSLQXETKLXA
Ga0193336_1040388313300019045MarineTWVSAKTTLYTVSGEIAYEEPEEMNLQINDWHPGQHEMLGASAYERVTPARFSADDDDIFMRSMIQNYAIDKNCAGKKEDPFPCGNFVMNEATMRAAASEVLCTHKGLCGAALASYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193336_1040570713300019045MarineTWVSAKTTLYTVSGEIAYEEPEEMNLQINDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGASLQSYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193336_1042533013300019045MarineAITLWTVTGEIAYTEEEPESMNIQLDDWHPGQHEMLGANAYERVTPARFSSDDDDIFMRSMIQNYAIEKNCTEDKDEPATTCGKFVMNEATMRAAASEVLATHKGLTGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193336_1059273813300019045MarineMNIQLDDWHPGQHETLGASAYERVIPARFSTDDDDIFMRSMYKNYAIDKNCADKDDPPVPCGKFVMNESTMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193336_1059900113300019045MarineMKFTIALAALLANAQAITIWTTKGQIAYEENDEDDVANVQLNDWHPGQHGTLGAGEYERVVPSRFASDDDDIFMRSMIANYAIDKNCAGKDDPPKPCGKFVMNEATMRAAASEVLCTHKGLCGASLGSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASD
Ga0192981_1021501413300019048MarineMKFTALALCLASTQAITLWTTTGEIAYEENDEEETNVQLSDWHAGQAGTLGNAEYARVVTPRFAADDDDIFMRSMIKNYAIEKATDDKENPVPTGKFIMNEATMRAAASEVLCTHKGLCGAALQGYMNSYYGKAWGHFDVNKTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0192981_1022082113300019048MarineMNVQLDDWHPGQHGTLGGLEYERVVTPRFAGDDDDIFMRSMISNYAIDKNCAGKDDPPASCGKFVMNEATMMAAASEVLCTHKGLCGAKLTSYLDTYFAKSWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192981_1022124613300019048MarineMKFTIALATFLGLAQAKTTLWTTLGEIAYEEDDEEDTNLQIDDWHPGQSGTAGAGEYARATPARFSADSDDIFMRSMIQNYAIDKNCAGPDDAPAPCGKFTMNQVTMRAAASEVLCTHKGLCGGALQKYLDTYYAKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192981_1023752413300019048MarineHGDNLINGIILIPKMKFAIAAFLGLAAARTTLYTTTGDIAFEQEDDDNMSLQLDDWHPGQSGTLGGAEYSRVTTARFSADDDDIFMRSMIQNFAIEKNSGGDGPAVASGKFVMNAITMRAAAAEVLATHKGLTGDKLSAYLTTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASD
Ga0192981_1025457913300019048MarineMGIININEIMKFALALIAAVTAHKVNDWHPGQHGTLGASDYERVIPARFSSDDDDIFMRSMIKSYAIDKNCAGPDDPPATCGKFVMNESTMRAAASEVLCTHKGLCGGKLQEYLDTYFAKSWGHFDVNRTGEIEVIKSPQFMRFIASDQYMSLQ
Ga0193082_1051632913300019049MarineTWGINFNGIIMKFAILALLGVASAKTTLYTVNGEVAYEGEGEDLLQLDDWHPGQHEMLGAAAYERVTPARFSADDDDVFMRSMIQNYAIDKNCESDKDKPAYPCGKFVMNEATMRAAASEVLCTHKGLCGGALGTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193082_1061520323300019049MarineARTTLFTTQGEVAYVEEDESSAVQIEDWHPGQHEMLGAGAYERVTPDRFSADADDIFMRSMIQNYAIDKNCAGKDDPPKPCGKFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192966_1016897913300019050MarineLLTVLIILTKMKFATLAALIGVSQAITLWTTTGEIAYYEQDEEEAGDAMNLQLDDWHPGQHGTLGGSEYERVIPDRFSTDSDDIFMRSMYNNYAIDKNCAGKDEDPVPCGKFVMNESTMRAAASEVLCTHKGLCGGKLGEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192966_1021814723300019050MarineMKFALAALLGLAQARTTLFTTQGEVAYVEEDDVQAVQIDDWHPGLSGQMGAGSYERVTPARFSGDSDDIFMRSMIGNYAIDKNCAGKDEDARPCGNFVMNKVTMRAAAGEVLATHKGLTGDKLNSYLGTYFDKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192826_1028415013300019051MarineDNEEMAADDMNIQLDDWHPGQHEMLGAKAYERVIPARFETDDDDIFMRSMIKNYAIDKNCEEDEDKDPYPCGKFVMNQATMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFIASDQYMSLQ
Ga0192826_1035578113300019051MarineTTQGEVAYVEEDDSAALQIDDWHPGLSGQLGAGAYERVTPDRFSGDADDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEIEVIKSPQFMRFLASDHTCPSNEQPVTCRLAGVSDLS
Ga0188866_102847813300019095Freshwater LakeLLGLAQARTTLFTTMGEVAYVEEDESAAVQIDDWHPGQSGTLGAGTYERTTPARFSGDSDDIFMRSMIGNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLATHKGLTGDKLNSYLGTYFDKAWGHFDVNQTGEIEVAKSPQFMRFLASDQYMSLQ
Ga0193153_101900813300019097MarineWGLLKMKFAIAALLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGSYERVTPARFSADSDDIFMRSMISNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193102_101667413300019099MarineEIAYTEEEPESMNIQLDDWHPGQHEMLGANAYERVTPARFSSDDDDIFMRSMIQNYAIEKNCTEDKDEPATTCGKFVMNEATMRAAASEVLATHKGLTGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192946_103949413300019103MarineAVAAKTTLYTTRGEIAYEEPEDLLQLDDWHPGQHEMLGAAAYERVTPARFSADEDDIFMRSMIQNYAIEKNCAADIKKDDPIACGNFIMNASTMRAAASEVLCTHKGLCGGALNTYLGTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192946_103961013300019103MarineASITLWTTTGEIAYFQQDDDVPDNMNLQIEDWIPGQHEMLGAAAYERVTPANFATDDDDIFMRSMIENYAIEKNCAEDVKKDDPVQCTPNKFVMNAATMTAAASEVLCTHKGLCGAALGAYLDTYFAKAWGHFDVNRTGEVEVIKCPQFMRFLASDQYMSLQ
Ga0193243_105300613300019116MarineHPGQHEMLGAAAYERVTPARFSTDDDDIFMRSMIQNYAIEKNCAADPKKDDPVSCGKFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193054_104027913300019117MarineMGIINFNGIIMKFAIAALLGAVSAKTTLYNTRGEVAYEEPEEMVQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGALQTYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193157_101646213300019118MarineGIINFNFNGIMKFALAALLGVANAITIWTVDGEIAYTEDDEPESMNLQLDDWHPGQHGTLGASEYERVIPARFSTDDDDIFMRSMHENYAIDKNCAGKDDPPAPCGKFVMNESTMRAAASEVLCTHKAICGAALQEYLNTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193157_101824813300019118MarineMGIINFNGIMKFTVAAALLCGYIQARTTLYTTRGQIAYQEDSDDDEQNIQIDDWHPGQSGTLGAGEYKRETPARFSADDDDIFMRSMINNYAIDKNCAGKDDPPAPCGKFVMNEATMRAAASEVLCTHKALCGASLGSYLDTYFQKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193157_102176013300019118MarineAITVWTVTGEIAYEENDEPEAMNIQLDDWHPGQHGTLGAAEYERVVPARFSSDDDDIFMRSMISNYAIDKNCAGPDDPPVPCGKFVMNEATMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193157_102201213300019118MarineAITVWTTRGEIAYEESESDDDETAIQLNDWHPGQSGTLGKAEYKRVVTPRFATDDDDIFMRSMIENYAIEKATEVKDGEKNADGTPKVEEPTGNFVMNEATMRAAASEVLCTHKGLCGGSLQKYLDTYFAKAWGHFDVNRSGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193157_102671923300019118MarineTGEIAYMTENDDDVNLQIDDWHPGQSGSLGIAYERVTPARFSADSDDIFMRSMIQNYAIDKNCAGKDDPPAPCGKFTMNPVTMRAAASEVLCTHKGLCGGALQKYLGTYFEKAWGHFDVNKSGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193157_103388513300019118MarineRGEVAYVEEDDVAALQIEDWHPGLSGQLGSGAYERVTPARFSGDADDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMSAAASEVLATHKGLTGDKLSSYLGTYFDKAWGHFDVNQTGEIEVGKTPQFMRFLASDQYMSLQ
Ga0192980_106246313300019123MarineFYYNLINGIILIPKMKFAIAAFLGLAAARTTLYTTTGDIAFEQEDDDNMSLQLDDWHPGQSGTLGGAEYSRVTTARFSADDDDIFMRSMIQNFAIEKNSGGDGPAVASGKFVMNAITMRAAAAEVLATHKGLTGDKLSAYLSTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASD
Ga0192980_108517713300019123MarineHGASTQAITLWTTTGEIAYEENDEEETNVQLSDWHAGQAGTLGNAEYARVVTPRFAADDDDIFMRSMIKNYAIEKATDDKENPVPTGKFIMNEATMRAAASEVLCTHKGLCGAALQGYMNSYYGKAWGHFDVNKTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193104_103496413300019125MarineMKFAIACLLGATNAITLWTVTGEIAYTEEEPESMNLQLNDWHPGQHEMLGADAYERVTPARFSTDDDDIFMRSMIQNYAIEKNCTEDKDDPPTTCGKFVMNEATMRAAASEVLATHKGLTGGKLQEYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193104_103957713300019125MarineHGTLQLDDWHPGQSGTLGAGEYERVVTPRFSGDDDDIFMRSMIANYAIDKNCAGPDDPPAPCGKFTMNPATMRAAASEVLATHKGLTGQALTTYLDTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193104_105712513300019125MarineALQIDDWHPGLSGQLGSGAYERVTPARFSGDSDDIFMRSMISNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193436_106661313300019129MarineQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGALQTYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0193089_110040123300019133MarineMNVQLDDWIPGQNSMLGASEYSRVMPARFATDDDDIFMRSMINNYAIETEDADKNPSGNFVMNESTMRAAASEVLCTHKGLCGSALQAYLGTYFAKAWGHFDVNRSGSIEVIKSPQFMRFIASDQYMSLQ
Ga0188870_1009445013300019149Freshwater LakeMKFATLAALIGATQAITLWTTTGQIAYFEADDQDTDAMNLQLDDWHPGQHGTLGASEYERVIPGRFSTDDDDIFMRSMYDNYAIDKNCAGKDDPPAPCGNFVMNQSTMRAAASEVLCTHKGLCGAALGTYLDTYFAKAWGHFDVNRTGEIEIIKSPQFMRFLASDQYMSLQ
Ga0188870_1010810613300019149Freshwater LakeKTLKMKFALVALLGLAQARTTLFTTMGEVAYVEEDESAAVQIDDWHPGQSGTLGAGTYERTTPARFSGDSDDIFMRSMIGNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLATHKGLTGDKLNSYLGTYFDKAWGHFDVNQTGEIEVAKSPQFMRFLASDQYMSLQ
Ga0188870_1011042613300019149Freshwater LakeGIIMKFAILALLGVASTKTTLYTTSGEIAYEEPEDLVQLDDWHPGQHGTLGAAEYERVTPARFASDSDDIFMRSMIENYAIDKNCAGKDEDPVPCGNFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0206687_185080213300021169SeawaterMKFATLALLGAVSAKTTLYNLNGEIAYEEPEDLVQLDDWHPGQHEMLGASAYERVMPARFAADSDDIFMRSMIKNYAIDKNCEEDEDKDPYPCGKFIMNESTMRAAASEVLCTHKGLCGGNLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0206694_101562313300021291SeawaterFITKMKYTIALAALLGLTHVEETQAITLWTTNGEIAYEESDDDEDQNVQLNDWHPGQSGTLGKSEYKRVVPARFASDDDDIFMRSMIGNYAIDKNCAGKDDPPAPCGKFVMNEATMRAAASEVLCTHKGLCGAALGNYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYM
Ga0206688_1062821913300021345SeawaterELYLITKMKYTLALAALLGLTHVEETNAITVWTTRGEIAYEESESDDDETAIQLNDWHPGQSGTLGKAEYKRIVTPRFATDDDDIFMRSMIENYAIEKATEVKDGEKNADGTPKVEEPTGNFVMNEATMRAAASEVLCTHKGLCGGSLQKYLDTYFAKAWGHFDVNRSGEVEVIKCPQFMRFLASDQYMSLQ
Ga0206688_1087201113300021345SeawaterMKYTLALAALLGLTHVEETNAITIWTTRGEIAYEEAESDDDNEAIQISDWHPGQSGTLGKAEYKRVITPRFSADDDDIFMRSMIENYAIEKSTECKDDEKMPDGSPCVELPTGKFVMNEATMRAASSEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0206688_1088592813300021345SeawaterYFITKMKYTLALAALLGLTHVEETNAITVWTTNGEIAYEESESDDETAAVQLSDWHPGQSGTLGKAEYKRVVTPRFASDDDDIFMRSMIENYAIEKATEVKEDEKNPDGTPKVEEPTGNFVMNEATMRAASSEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRSGEVEVIKSPQFMRFLASDQYMSLQ
Ga0206688_1090080313300021345SeawaterKMKFTLAIAALLGYSQAITLWTTNGEIAYEEDDDEEQNIQLDDYHPGQSGTLGAAEYSRVVPARFSSDDDDIFMRSMISNYAIEAATKKGVPLGTFYMNEATMRAAASEVLCTHKALCGAALSKYLDTYFAKAWGHFDVNRAGSVEVIKSPQFMRFLASDQYMSLQ
Ga0206695_106066513300021348SeawaterELYFITKMKYTIALAALLGLTHVEETQAITLWTTNGEIAYEESDDDEDQNVQLNDWHPGQSGTLGKSEYKRVVPARFASDDDDIFMRSMINNYAIEKANDDDEPTGKFVMNEATMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0206695_126944513300021348SeawaterMKFTIALAAFLGLAQARTTLWTTLGEIAYEEDDEDTNVQIDDWHPGQSGTLGAGEYERATPARFSADSDDIFMRSMIQNYAIDKNCAGKDDPPAPCGKFTMNQVTMRAAASEVLCTHKGLCGGALQKYLDTYYAKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0206695_142062313300021348SeawaterMKFAILALLGAVSAKTTLFTTQGEIAYEQNDDLVQIDDWHPGLSGQLGAGEYSRVTPARFATDDDDIFMRSMINNYAIETEDADKNPSGKFIMNESTMRAAASEVLCTHKGLCAGALQAYLDTYFAKAWGHFDVNRTGSVEVIKCPQFMRFLASDQYMSLQ
Ga0206692_187300413300021350SeawaterMKFATLALLGAVSAKTTLYNLNGEIAYEEPEDLVQLDDWHPGQHEMLGASAYERVMPARFAADSDDIFMRSMIKNYAIDKNCEEDEDKDPYPCGKFIMNESTMRAAASEVLCTHKGLCGKALAGYLGTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0206690_1029287413300021355SeawaterMKFALACLLGAANAITLWTVKGDIAYEEDDEPESMNIQLDDWHPGQHGTLGASEYERVVPARFSTDDDDIFMRSMISNYAIDKNCAGKDDPPAPCGKFVMNEATMRAASSEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRVGEIEVIKSPQFMRFLASDQYMSLQ
Ga0206690_1039465813300021355SeawaterANMKFTILALLGFAAARTTLYTTHGEIAYQQEDDDEINIMLDDWHPGQTGTLGAGEYERVVPARFAADSDDIFMRSMIANYAIDKNCAGKDDPPSPCGKFTMNPVTMRAAASEVLCTHKGLCGAALQTYLTTYFDKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0206690_1072083613300021355SeawaterLGLTHVEETNAITVWTTRGEIAYEESESDDDETALQLNDWHPGQSGTLGKAEYKRIVTPRFATDDDDIFMRSMIENYAIEKSTECKDDEKMPDGSPCVELPTGKFVMNEATMRAASSEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0206690_1080739213300021355SeawaterKGEIAYEEYDDETNLQLDDWHPGQSGTLGGAEYARTIPARFSTDDDDIFMRSMIANYAIDKNCAGKDDPPAPCGKFVMNQATMRAASSEVLCTHKGLCGSALQTYLDTYFAKAWGHFDVNRVGEIEVIKSPQFMRFLASDQYMSLQ
Ga0206690_1083785013300021355SeawaterLLTRMKFAALAALIGFTQAITIWTTHGEIAYEEDDEETNIQLDDWHPGQSGTLGSGEYARVVPARFAGDDDDIFMRSMIANYAIDKNCAGKDDPPAPCGKFTMNESTMRAAASEVLCTHKGLCGGALTTYLDTYFQKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0206689_1044613113300021359SeawaterMKFAVLALLGFANARTTLWTTQGEIAFSEDDEENNLMINDWHPGQSGTLGAGDYSRVTPDRFSSDDDDIFMRSMIQNYAIDKNCAGKDDPAKPCGKFTMNAIIMRAAASEVLCTHKGLCGDKLQKYLDTYFAKAWGHFDVNKSGEIEVIKSPQFMRFLASDQYMSLQ
Ga0206689_1078543213300021359SeawaterLYFITKMKYTLALAALLGLTHVEETNAITVWTTNGEIAYEESESDEDEAAVQLSDWHPGQSGTLGKAEYKRVVTPRFASDDDDIFMRSMIENYAIEKATEVKDGDKNPDGTPKVEEPTGNFVMNEATMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRSGEVEVIKSPQFMRFLASDQYMSLQ
Ga0063109_10449713300021866MarineYKMKFAIAALIGAAAAKTTLWTTRGEIAYEEDDNETTNIMLDDWHPGQSGTLGAGEYERVTPARFAADSDDIFMRSMIQNYAIDKNCAGPDDPPKPCGKFTMNEVTMRAAASEVLCTHKGLCGGALQKYLDTYFTKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063107_10095413300021869MarineMKFTLAVALLIGATQSITLWTTAGEIAYEENDDEEEMNVQISDWHPGQHGTLGAGEYERVIPARFAADSDDIFMRSMINNYAIDKNCAGKDDPPAPCGTFTMNESTMRAAASEVLCTHKGLCGAALETYLGTYFAKSWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSL
Ga0063107_10096013300021869MarineGIILLANMKFAIFALLGFTAARTTLYNMEGQITYMTEDDEVNLQLDDWHPGQSGTSGAAEYARVTPARFSADSDDIFMRSMIQNFAIDKNCAGPDDPPASCGKFTMNPVTMRAAASEVLATHKGLTGAALQTYLTTYFEKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063107_10761413300021869MarineIIIIIMKFAILALIGAVAAKTTLYRTNGEIAYEQEDEENLMIEDWHPGQSGTLGGAEYARTTPARFSADSDDIFMRSMIQNYAIDKNCAGKDDPPAPCGTFTMNQATMRAAASEVLATHKGLAGAALQTYLDTYFSKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063132_10108413300021872MarineKIQMKFAVAAALLGAANAITLWTVHGEIAYEEDDEEAMNVQLDDWHPGQHEMLGAAAYERVTPARFSTDDDDIFMRSMIQNYAIDKNCAGKDEPPVPCGKFVMNEATMRAAASEVLCTHKALCGASLQTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063132_10552813300021872MarineMKFAILALVGAASARTTLFRTNGQIAYEEADDLNIQLDDWHPGQHGTLGAGEYERVTPARFSADSDDIFMRSMINNYAIDKNCAGPDDPPAPCGKFVMNASTMRAAASEVLCTHKALCGAALESYLGTYFDKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0063132_10720913300021872MarineLLKMKFALAALLGLAQARTTLFTTQGEVAYVEDDESTAVQVDDWHPGLSGQLGAGSYERVTPARFSGDADDIFMRSMIQNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKAWGHFDVNQTGEVEVGKSPQFMRFLASDQYMSLQ
Ga0063132_10797513300021872MarineFAALALLGAVSARTTLYNTRGEIAYQTMDDDNINLQLDDWHPGQHGTLGAGEYERVTPARFSADSDDIFMRSMINNYAIDKNCAGPDDPPAPCGKFTMNAVTMRAAASEVLCTHKALCGGELQKYLDTYFDKAWGHFDVNKSGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063118_100422613300021880MarineMKYTLALAALLGLTHVEETSAITLFTTNGEVAYEESDSDDDEQAVQLNDWHPGQSGTLGKAEYKRVVTPRFSTDDDDIFMRSMIENYAIEDDGCPKSKDDDPDCVETPTGKFYMTEGTMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRGGKVEVIRSPQFMRFLASDQYMSLQ
Ga0063117_101150513300021881MarineLNMKYTLALAALLGLTHVEETSAITLFTTNGEVAYEESDSDDDEQAVQLNDWHPGQSGTLGKAEYKRVVTPRFSTDDDDIFMRSMIENYAIEDDGCPKSKDEDPDCVESPTGKFYMTEGTMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRGGKVEVIRSPQFMRFLASDQYMSLQ
Ga0063117_103093913300021881MarineDETALQINDWHPGQSGTLGNAEYKRVVTPRFATDDDDIFMRSMIENYAIEKATEVKDGEKNPDGTPKVEEPTGNFVMNEATMRAAASEVLCTHKGLCGGTLQKYLDTYFAKAWGHFDVNRSGEVEVIKCPQFMRFLASDQYMSLQ
Ga0063125_100646913300021885MarineLKMKFALAALLGLAQARTTLYTTMGEVAYVEEDESAAIQIDDWHPGLSGQLGAGSYERVTPARFSGDADDIFMRSMINNYAIDKNCAGKDEDPKPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKSWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0063125_100848413300021885MarineILLKMKFAIAALLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGSYERVTPARFSADSDDIFMRSMISNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYYDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0063125_100996413300021885MarineKFALACLLGATNAITLWTVTGEIAYTEEEPESMNIQLDDWHPGQHEMLGANAYERVTPARFSSDDDDIFMRSMIQNYAIEKNCTEDKDEPATTCGKFVMNEATMRAAASEVLATHKGLTGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063125_101355413300021885MarineEDLVQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFIMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063105_101485813300021887MarineIIMKFAILALIGAVAAKTTLYRTNGEIAYEQEDEENLMIEDWHPGQSGTLGGAEYARTTPARFSADSDDIFMRSMIQNYAIDKNCAGKDDPPAPCGTFTMNQATMRAAASEVLATHKGLAGAALQTYLDTYFSKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063105_103530613300021887MarineKFTLAAALLIGATQSITLWTTAGEIAYEENDDEEEMNVQISDWHPGQHGTLGAGEYERVIPARFAADSDDIFMRSMINNYAIDKNCAGKDDPPAPCGTFTMNESTMRAAASEVLCTHKGLCGAALETYLGTYFAKSWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063097_100658813300021898MarineIIIMKFAILALIGAVAAKTTLYRTNGEIAYEQEDEENLMIEDWHPGQSGTLGGAEYARTTPARFSADSDDIFMRSMIQNYAIDKNCAGKDDPPAPCGTFTMNQATMRAAASEVLATHKGLAGAALQTYLDTYFSKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063097_101087623300021898MarineMNLQLDDWHPGQHGTLGASEYVRVVPARFSSDDDDIFMRSMINNFAIDKNCAGKDDPPAPCGTFTMNEATMRAASSEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063086_100168813300021902MarineIMKFAILALLGVVSAKTTLYTTQGEIAYEQNDDLVQIDDWHPGLSGQLGAGEYSRVTPARFATDDDDIFMRSMINNYAIEKDADGAPTGNFIMNESTMRAAASEVLCTHKGLCGGALQAYLDTYFAKAWGHFDVNRTGSVEVIKCPQFMRFLASDQYMSLQ
Ga0063086_100238013300021902MarineMKFAILALLGVVSAKTTLYRTNGEVAYEEPEDLVQLDDWHPGQTGTLGAAEYSRVVPARFASNDDDIFMRSMISNYAIEKADGDGAPTGNFVMNESTMRAAASEVLCTHKGLCAAALQTYLDTYFSKAWGHFDVNRTGAIEVIKSPQFMRFLASDQYMSLQ
Ga0063100_106936513300021910MarineMNFAILALLGVVSAKTTLYKTNGEIAMEVPEDLVQLDDWHPGQTGTLGAGEYARVTPARFASDDDDIFMRSMISNYAIDKNCAAGDAPPAPCGKFTMNESTMRAAASEVLCTHKGLCGGELGTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063106_113549213300021911MarineLNMKFAIVALLGLVEAKTTLFTTQGEVAYVEEDESNLMIEDWHPGLSGQAGAGEYSRVTPARFSADSDDIFMRSMINNYAIDKNCAGGDAPPAPCGKFTMNKVTMRAAASEVLCTHKAVCGAALQAYLGTYFDKSWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063133_101288613300021912MarineFALAALLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0063133_103015913300021912MarineILTIMKYTTLACLLGATQASITLWTTKGEIAYFEDDENTDAMNLQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQSTMRAAASEVLCTHKGLCGAKLGEYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0063133_104456413300021912MarineKFATLVCLIGASQAITLWTTKGEIAYFEADQDEEQEAMNIQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQATMRAAASEVLCTHKGLCGGALQTYLDTYFQKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0063104_103618313300021913MarineIMKFTLAAALLIGATQSITLWTTAGEIAYEENDDEEEMNVQISDWHPGQHGTLGAGEYERVIPARFAADSDDIFMRSMINNYAIDKNCAGKDDPPAPCGTFTMNESTMRAAASEVLCTHKGLCGAALETYLGTYFAKSWGHFDVNKTGEIEVIKSPQFMRFLASDQYM
Ga0063085_101862113300021924MarineMKFAILALLGVVSAKTTLYTTQGEIAYEQNDDLVQIDDWHPGLSGQLGAGEYSRVTPARFATDDDDIFMRSMINNYAIEKDADGAPTGNFIMNESTMRAAASEVLCTHKGLCGGALQAYLDTYFAKAWGHFDVNRTGSVEVIKCPQFMRFLASDQYMSLQ
Ga0063096_100678713300021925MarineRTNGEIAYEEADDLNVQISDWHPGQSGTLGNAEYARVTPARFSSDDDDIFMRSMIQNYAIDKNCSGPDDAPTTCGKFTMNQSSMQAAASEVLCTHKAICGGALSAYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063096_100751913300021925MarineMKFALAAALLGAANAITLWTVKGEIAYEEDEEPESMNVQLDDWHPGQHGTLGNAEYSRVVPARFSTDDDDIFMRSMINNYAIDKNCAGKDDPPAPCGKFTMNEATMRAAASEVLCTHKAICGGALQTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFIASDQYMSLQ
Ga0063096_100804913300021925MarineLLGAVSAKTTLFTTTGEIAYEQNDEDDVNLMIDDWHPGQSGTLGSGEYARVTPARFAADSDDIFMRSMINNYAIDKNCAGPDDAPAPCGKFTMNAITMRAAASEVLCTHKAICGAALQSYLSTYFDKAWGHFDVNKSGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063096_101571113300021925MarineMKFTIALACFLGYTQAITLWTTTGEIAYEESDEETENVQLNDWHAGQTGTLGNAEYARVVTPRFAADDDDIFMRSMIKNFAIEKSTEGTEEHPSVPTGKFVMNEATMRAAAQEVLCTHKGLCGAALSSYMNTYFGKSWGHFDVNKTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0063096_101916413300021925MarineAIVALLGLVQAKTTLFTTQGEVAYVGDDEENLMIEDWHPGLSGQAGAGEYSRVTPARFAADSDDIFMRSMINNYAIDKNCAGADDAPAPCGKFTMNKVTMRAATSEVLCTHKAICGAALQAYLSTYFDKSWGHFDVNQTGEIEVIKSPQFMRFIASDQYMSLQ
Ga0063096_102154613300021925MarineLLGVVSAKTTLYRTNGEIAYEANDDLVQIDDWHPGQSGTLGNAEYARVTPARFASDDDDIFMRSMIQNYAIDKNCSGPDDPPTTCGKFTMNQATMRAAASEVLATHKGLAGAALGTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063096_102697413300021925MarineTMKFATLACLLGAANAITLWTVKGEIAYEENDEPEAMNVQLDDWHPGQHGTLGASDYSRVVPARFATDDDDIFMRSMIANYAIDKNCSGPDDPPTSCGKFTMNESTMRAAASEVLCTHKGLCGGELQSYLDTYFAKSWGHFDVNRTGEIEVIKSPQFMRFIASDQYMSLQ
Ga0063134_110141213300021928MarineRTTLWTTRGEIAYMEEDEENNLQIDDWHPGQSGTLGAGEYERVTPSRFSADSDDIFMRSMIQNYAIDKNCAGPDDPAKPCGKFTMNPVTMRAAASEVLCTHKGLCGAALQSYLGTYFDKAWGHFDVNKSGEVEVMKSPQFMRFLASDQYMSLQ
Ga0063095_100469413300021939MarineILLANMKFAIFALLGFTAARTTLYNMEGQITYMTEDDEVNLQLDDWHPGQSGTSGAAEYARVTPARFSADSDDIFMRSMIQNFAIDKNCAGPDDPPASCGKFTMNPVTMRAAASEVLATHKGLTGAALQTYLTTYFEKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063095_105309513300021939MarineKFTLAVALLIGATQSITLWTTAGEIAYEENDDEEEMNVQISDWHPGQHGTLGAGEYERVIPARFAADSDDIFMRSMINNYAIDKNCAGKDDPPAPCGTFTMNESTMRAAASEVLCTHKGLCGAALETYLGTYFAKSWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063102_102551513300021941MarineIIMNFAILALLGVVSAKTTLYKTNGEIAMEVPEDLVQLDDWHPGQTGTLGAGEYARVTPARFASDDDDIFMRSMISNYAIDKNCAAGDAPPAPCGKFTMNESTMRAAASEVLCTHKGLCGGELGTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063102_102938613300021941MarineELLLLNMKFAIVALLGLVEAKTTLFTTQGEVAYVEEDESNLMIEDWHPGLSGQAGAGEYSRVTPARFSADSDDIFMRSMINNYAIDKNCAGGDAPPAPCGKFTMNKVTMRAAASEVLCTHKAVCGAALQAYLGTYFDKSWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063102_103649013300021941MarineIMKFAILALIGAVAAKTTLYRTNGEIAYEQEDEENLMIEDWHPGQSGTLGGAEYARTTPARFSADSDDIFMRSMIQNYAIDKNCAGKDDPPAPCGTFTMNQATMRAAASEVLATHKGLAGAALQTYLDTYFSKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063102_104210013300021941MarineGIILLANMKFAIFALLGFTAARTTLYNMEGQITYMTEDDEVNLQLDDWHPGQSGTSGAAEYARVTPARFSADSDDIFMRSMIQNYAIDKNCAGSDDPPASCGKFTMNPVTMRAAASEVLATHKGLTGAALQTYLTTYFEKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063094_100107213300021943MarineILLANMKFAIFALLGFTAARTTLYNMEGQITYMTEDDEVNLQLDDWHPGQSGTSGAAEYARVTPARFSADSDDIFMRSMIQNYAIDKNCAGPDDPPASCGKFTMNPVTMRAAASEVLATHKGLTGAALQTYLTTYFEKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063094_101245823300021943MarineMNLQLDDWHPGQHGTLGASEYVRVVPARFSSDDDDIFMRSMINNYAIDKNCAGKDDPPAPCGTFTMNEATMRAASSEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063094_102522113300021943MarineIIMKFAVLALLGVVAAKTTLYRTNGEIAYEQEDEENLMIEDWHPGQSGTLGSGEYARVTPARFSADSDDIFMRSMINNYAIDKNCAGKDDPPAPCGTFTMNQATMRAAASEVLATHKGLTGAALQTYLDTYFAKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063094_104118913300021943MarineKFATLACLLGAANAITLWTVKGEIAYEENDEPEAMNVQLDDWHPGQHGTLGASDYSRVVPARFATDDDDIFMRSMIANYAIDKNCSGPDDPPTSCGKFTMNESTMRAAASEVLCTHKGLCGGELQSYLDTYFAKSWGHFDVNRTGEIEVIKSPQFMRFIASDQYMSLQ
Ga0063101_101253413300021950MarineMKFALACLLGAANAMTIYTTTGEVAYEENDEPEAMNLQLDDWHPGQHGTLGASEYVRVVPARFSSDDDDIFMRSMINNFAIDKNCAGKDDPPAPCGTFTMNEATMRAASSEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063101_104503513300021950MarineLLLLNMKFAIVALLGLVEAKTTLFTTQGEVAYVEEDESNLMIEDWHPGLSGQAGAGEYSRVTPARFSADSDDIFMRSMINNYAIDKNCAGGDAPPAPCGKFTMNKVTMRAAASEVLCTHKAVCGAALQAYLGTYFDKSWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063101_108120213300021950MarineKFTLAVALLIGATQSITLWTTAGEIAYEENDDEEEMNVQISDWHPGQHGTLGAGEYERVIPARFAADSDDIFMRSMINNYAIDKNCAGKDDPPAPCGTFTMNESTMRAAASEVLCTHKGLCGAALETYLGTYFAKSWGHFDVNKTGEIEVIKSPQFMRFLASDQYMS
Ga0063101_117208813300021950MarineMNLQLDDWHPGQSGTLGGAEYARATPARFSADEDDIFMRSMINNYAIDKNCAGKDDPPAPCGNFVMNEATMTAAASEVLCTHKGLCGGKLAAYLGTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSL
Ga0063101_122591813300021950MarineKFTTLACLLGATNAITLWTVKGEIAYEENDEPEAMNVQLDDWHPGQHGTLGATDYSRVVPARFSTDDDDIFMRSMISNYAIDKNCAGPDDPPASCGKFTMNESTMRAAASEVLCTHKGLCGGKLQEYLDTYFAKSWGHFDVNRTGEIEVIKSPQFMRFIASDQYMS
Ga0222717_1061568413300021957Estuarine WaterMKFALVALLGLAQARTTLFTTMGEVAYVEEDESAAVQIDDWHPGLSGQLGAGSYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKAWGHFDVNQTG
Ga0222716_1029925613300021959Estuarine WaterMKFALVALLGLAQARTTLFTTMGEVAYVEEDESAAVQIDDWHPGLSGQLGAGSYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKAWGHFDVNQTGEIEVGKSPQFMRFLASDQYMSLQ
Ga0232113_102490023300023679SeawaterLKMKFALAALLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0228680_102728513300023695SeawaterILLKMKFALAALLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0228687_102824813300023696SeawaterLLKMKFALAALLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0228682_103915313300023698SeawaterKMKFALAALLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPVLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLCTHKGLCGAKLGEYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0228685_105827713300023701SeawaterTIMKFTTLACLLGATQASITLWTTKGEIAYFEDDENTDAMNLQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQATMRAAASEVLCTHKALCGGALQTYLDTYFQKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0228684_105193113300023704SeawaterMKFATLALIGAVSAKTTVYRTTGEVAYEEPEDLLQIDDWHPGQDGTLGGAGYLKNITARFSADSDDIFMRSMLNNYAIDKNCAGKDDPPVPCGKFVMNEATMRAAASEVLCTHKGLCGGALTSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247557_103239913300026403SeawaterARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247581_108322013300026420SeawaterLTIMKYTTLACLLGATQASITLWTTKGEIAYFEDDENTDAMNLQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQSTMRAAASEVLCTHKGLCGAKLGEYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYM
Ga0247591_106656413300026434SeawaterKMKFALAALLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLCTHKGLCGGALTSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247607_105614213300026447SeawaterKILTKMKFAALAALIGATQAITLWTTTGQIAYYEQDEDFDAMNLQLDDWHPGQHEMLGASAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGASLGAYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247594_103204413300026448SeawaterLLKMKFALAALLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLCTHKGLCGGALTSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247594_107568613300026448SeawaterSTKTTLYTTRGEIAYEELEDLVQLDDWHPGQHEMLGAAAYERVTPARFSADDDDIFMRSMIQNYAIEKNCESDADKPAISCGKFVMNEATMRAAASEVLCTHKGLCGGALGTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247593_108290113300026449SeawaterKFAILALVGAVSAKTTLYTTRGEIAYEEPEDLVQLDDWHPGQHGTLGGAEYTRVIPARFETDSDDIFMRSMLNNYAIEKDDAGKDEDPHPSGKFVMTQSTMRAAASEVLCTHKGLCGAALESYLGTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247600_110626813300026461SeawaterAAQAITIYTTTGEIAFQSEDDEAMNIQLDDWHPGQHEMLGASAYERVTPARFSTDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247568_107554313300026462SeawaterMKFALVALLGLAQARTTLFTTMGEVAYVEEDESAAVQIDDWHPGLSGQLGAGEYARVTPARFSADSDDIFMRSMIGNYAIDKNCAGKDEDPRPCGNFVMTKNTMRAAATEVLCTHKGLCGGAGQKYLDTYFAKAWGHFDVNQGGEVEVIRAPQFMRFLASD
Ga0247568_108274613300026462SeawaterATQAITLWTTTGQIAYYEQDEDFDAMNLQLDDWHPGQHEMLGASAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGALGTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247603_112305613300026468SeawaterGASQAITLWTTKGEIAYFEADQDEEQEAMNIQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQSTMRAAASEVLCTHKGLCGAKLGDYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247599_108831213300026470SeawaterLKMKFALAALLGLAQARTTLFTTMGEVAYVEEDNESAAIQIDDWHPGLSGQLGSGAYERVTPARFSGDADDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQSGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247602_113265413300026471SeawaterQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247592_111433623300026500SeawaterMKFALIALLGAAQARTTLFTTQGEVAYVEDDEATNLQIDDWHPGLSGQLGAGEYARVTPARFSADSDDIFMRSMIGNYAIDKNCAGKDEDPRPCGNFVMTKNTMRAAATEVLCTHKGLCGGAGQKYLDTYFAKAWGHFDVNQGGEVEVIRAPQFMRFLASD
Ga0247592_112045013300026500SeawaterMKFAILALVGAVSAKTTLYTTRGEIAYEEPEDLVQLDDWHPGQHGTLGGAEYTRVIPARFETDSDDIFMRSMLNNYAIEKDDAGKDEDPHPSGNFVMTQSTMRAAASEVLCTHKGLCGAALESYLGTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247592_116132613300026500SeawaterDDWHPGLSGQLGSGAYERVTPARFSGDADDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQSGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247605_116831313300026503SeawaterVAYVEDDEATNLQIDDWHPGLSGQLGAGEYARVTPARFSADSDDIFMRSMIGNYAIDKNCAGKDEDPRPCGNFVMTKNTMRAAATEVLCTHKGLCGAAGQKYLDTYFAKAWGHFDVNQGGEVEVIRAPQFMRFLASDQYMSLQ
Ga0247587_110348523300026504SeawaterLTIMKYTTLACLLGATQASITLWTTKGEIAYFEDDENTDAMNLQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQSTMRAAASEVLCTHKGLCGAKLGEYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247587_111514213300026504SeawaterMKFAIAALLGAVSAKTTLYTTTGEIAYEEPEEMNLQINDWHPGQHGTLGGAAYERVIPARFSGDSDDIFMRSMLNNYAIDKNCAGKDDPPAPCGKFIMNKVTMRAAASEVLCTHKGLCGDALESYLGTYFDKAWGHFDVN
Ga0247587_111570013300026504SeawaterNLLKMKFALAALLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247587_112445213300026504SeawaterLIGASQAITLWTTKGEIAYFEADQDEEQEAMNIQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQATMRAAASEVLCTHKALCGGALQTYLDTYFQKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247590_111686813300026513SeawaterGWNTMKFATLAALLGATQAITLWTTTGQIAYYENDDDMPDAMNVQIDDWHPGQHGTLGGAEYTRVIPARFETDGDDIFMRSMYNNYAIEKDDAGKDEDPHPSGKFVMNQSTMRAAASEVLCTHKGLCGGALNTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247590_113194213300026513SeawaterGIIMKFAILALVGAVSAKTTLYTTRGEIAYEEPEDLVQLDDWHPGQHGTLGGAEYTRVIPARFETDSDDIFMRSMLNNYAIEKDDAGKDEDPHPSGKFVMTQSTMRAAASEVLCTHKGLCGAALESYLGTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247590_116275313300026513SeawaterILTKMKFAALAALIGATQAITFWTTTGQIAYYEQDEDFDAMNLQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGALTSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247590_116871713300026513SeawaterLKMKFALAALLGLAQARTTLFTTMGEVAYVEEDNESAAIQIDDWHPGLSGQLGSGAYERVTPARFSGDADDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYCDKAWGHFDVNQSGEVEVIKSPQFMRFLASDQYMSLQ
Ga0209302_1018647413300027810MarineMKFAIFALLGFTAARTTLYNMEGQITYMTEDDEVNLQLDDWHPGQSGTSGAAEYARVTPARFSADSDDIFMRSMIQNFAIDKNCAGPDDPPASCGKFTMNPVTMRAAASEVLATHKGLTGAALQTYLTTYFEKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0209302_1019697213300027810MarineMKFAILALIGAVAAKTTLYRTNGEIAYEQEDEENLMIEDWHPGQSGTLGGAEYARTTPARFSADSDDIFMRSMIQNYAIDKNCAGKDDPPAPCGTFTMNQATMRAAASEVLATHKGLAGAALQTYLDTYFSKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247586_106637913300028102SeawaterNLQVEDWHPGQHGTLGAGAYERVVPDRFSGDSDDIFMRSMINNYAIDKNCAGKDDPPAPCGKFVMNQATMRAAASEVLCTHKALCGGALQTYLDTYFQKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247596_108124413300028106SeawaterGEIAFQSEDDEAMNIQLDDWHPGQHEMLGASAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGALTSYLDTYFAKAWGHFDVNRTGEIEVIKSP
Ga0247596_110507313300028106SeawaterMKFAILALLGVASTKTTLYTTRGEIAYEEPEDLVQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247596_115907613300028106SeawaterRNTMKFATLAALLGATQAITLWTTTGQIAYYENDDDMPDAMNVQIDDWHPGQHGTLGGAEYTRVIPARFETDGDDIFMRSMYNNYAIEKDDAGKDEDPHPSGKFVMNQSTMRAAASEVLCTHKGLCGGALNTYLDTYFTKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYM
Ga0247584_113785113300028110SeawaterMKYTTLACLLGATQASITLWTTKGEIAYFEDDENTDAMNLQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQSTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0256411_112700613300028134SeawaterKFAIAALLGVISAKTTLYTTSGEIAYEEPEDLVQLDDWHPGQHEMLGAAAYERVTPARFSADDDDIFMRSMIQNYAIDKNCAGKKEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGALTSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0256411_118770913300028134SeawaterGIKLLKMKFALAALLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0256411_118802713300028134SeawaterGMKFATLVCLIGASQAITLWTTKGEIAYFEADQDEEQEAMNIQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQATMRAAASEVLCTHKALCGGALQTYLDTYFQKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0256411_119549913300028134SeawaterMKFATLALIGAVSAKTTVYRTTGEVAYEEPEDLLQIDDWHPGQDGTLGGAEYSRVIPARFSADSDDIFMRSMLNNYAIDKNCAGKDDPPVPCGKFVMNEATMRAAASEVLCTHKGLCGGALTSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0256411_121220913300028134SeawaterVASTKTTLYTTRGEIAYEEPEDLVQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0256411_121647113300028134SeawaterTELKILTIMKFTTLACLLGATQASITLWTTKGEIAYFEDDENTDAMNLQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQSTMRAAASEVLCTHKGLCGAKLGDYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0256411_122241213300028134SeawaterIMKYAALLALANARTTLFTTRGEVAYVEADDEVAAVQIDDWHPGLSGQLGSGAYERVTPARFSGDADDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQSGEVEVIKSPQFMRFLASDQYMSLQ
Ga0256411_125562613300028134SeawaterMKFAILALLGFTNCKTTLFTTTGQVAYQADDDLVQLDDWHPGQHEMLGASAYERVTPARFSSDDDDIFMRSMIQNYAIEKNCESDEDKPPISCGKFVMNEATMRAASSEVLCTHKALCGGALQAYLDTYFAKAWGHFDVNRTGEIEVIKCPQFMRFLASDQYMSLQ
Ga0256412_121694613300028137SeawaterKILTKMKFAALAALIGATQAITLWTTTGQIAYYEQDEDFDAMNLQLDDWHPGQHEMLGASAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGASLGAYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSL
Ga0256412_122684413300028137SeawaterMKFALIALLGGAQIIKTIFTTQGEVAYVEDDEATNLQIDDWHPGLSGQLGAGEYARVTPARFSADSDDIFMRSMIGNYAIDKNCAGKDEDPRPCGNFVMTKNTMRAAATEVLCTHKGLCGGAGQKYLDTYFAKAWGHFDVNQGGEVEVIRAPQFMRFLASD
Ga0256412_123680413300028137SeawaterELKILTIMKYTTLACLLGATQASITLWTTKGEIAYFEDDENTDAMNLQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQSTMRAAASEVLCTHKGLCGAKLGDYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0256412_125614313300028137SeawaterATLVCLIGASQAITLWTTKGEIAYFEADQDEEQEAMNIQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQATMRAAASEVLCTHKALCGGALQTYLDTYFQKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0256412_126747513300028137SeawaterAILALLGVASTKTTLYTTRGEIAYEEPEDLVQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0256412_136832013300028137SeawaterMKFAIAALLGAVSAKTTLFTTTGEIAYEEPEEMNLQINDWHPGQHGTLGGAAYERVIPARFSGDSDDIFMRSMLNNYAIDKNCAGKDDPPAPCGKFIMNKVTMRAAASEVLCTHKGLCGAALESYLGTYFDKAWGHFDVN
Ga0256417_111910513300028233SeawaterKILTIMKFTTLACLLGATQASITLWTTKGEIAYFEDDENTDAMNLQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQSTMRAAASEVLCTHKGLCGAKLGEYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0256417_113481413300028233SeawaterMKFAIAALLGAVSAKTTLYTTTGEIAYEEPEEMNLQINDWHPGQHGTLGGAAYERVIPARFSGDSDDIFMRSMLNNYAIDKNCAGKDDPPAPCGKFIMNKVTMRAAASEVLCTHKGLCGAALESYLGTYFDKAWGHFDVN
Ga0256417_114157813300028233SeawaterKFALAALLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0256417_120348513300028233SeawaterMKFATLACLLGFNNAITLWTTKGQIAYYENDEEPEAMNIQLDDWHPGQHEMLGASAYERVTPARFSSDDDDIFMRSMIQNYAIEKNCESDEDKPPISCGKFVMNEATMRAAASEVLCTHKALCGGSLQAYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247560_11804913300028250SeawaterVQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0256413_121509613300028282SeawaterRNTMKFATLAALLGATQAITLWTTTGQIAYYENDDDMPDAMNVQIDDWHPGQHGTLGGAEYTRVIPARFETDGDDIFMRSMYNNYAIEKDDAGKDEDPHPSGKFVMNQSTMRAAASEVLCTHKGLCGGALNTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0256413_123314413300028282SeawaterNGMKFATLVCLIGASQAITLWTTKGEIAYFEADQDEEQEAMNIQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQATMRAAASEVLCTHKALCGGALQTYLDTYFQKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0256413_124669313300028282SeawaterMKFALIALLGVAQARTTLFTTQGEVAYVEDDEATNLQIDDWHPGLSGQLGAGEYARVTPARFSADSDDIFMRSMIGNYAIDKNCAGKDEDPRPCGNFVMTKNTMRAAATEVLCTHKGLCGGAGQKYLDTYFAKAWGHFDVNQGGEVEVIRAPQFMRFLASD
Ga0256413_126568513300028282SeawaterFAILALLGVASTKTTLYTTRGEIAYEEPEDLVQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCIHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0256413_130878413300028282SeawaterEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0256413_134591313300028282SeawaterMKFAALALLGAVSARTTIYNTRGEIAYQTMDDDYVNLQVDDWHPGQSGTLGAGEYERVTPARFSADSDDIFMRSMINNYAIDKNCAGPDDPPAPCGKFVMNASTMRAAASEVLCTHKALCGGALESYLGTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247572_111060913300028290SeawaterAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQSGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247572_111545013300028290SeawaterIIMKFTTLACLLGASQAITLWTTSGEIAYFENDEEEPEAMNIQLDDWHPGQHEMLGAAAYERVTPARFSADDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPHFMRFLASDQYMSLQ
Ga0247572_114791313300028290SeawaterEDLVQLDDWHPGQHGTLGGAEYTRVIPARFETDSDDIFMRSMLNNYAIEKDDAGKDEDPHPSGKFVMTQSTMRAAASEVLCTHKGLCGGALNTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSL
Ga0247595_106234813300028333SeawaterLLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDADDIFMRSMIGNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247597_103745113300028334SeawaterKFAILALVGALSAKTTLYTTRGEIAYEEPEDLVQLDDWHPGQHGTLGGAEYTRVIPARFETDSDDIFMRSMLNNYAIEKDDAGKDEDPHPSGKFVMNQSTMRAAASEVLCTHKGLCGGALNTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0247597_103947113300028334SeawaterLAALLGLAQARTTLFTTSGEVAYVEDDESAALQIDDWHPGLSGQLGSGAYERVTPARFSGDADDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQSGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247597_104108313300028334SeawaterLTKMKFTALAALIGATQAITLWTTHGEIAYFEADDEVSDEMNLQIDDWHPGQHEMLGAAAYERVTPARFASDDDDIFMRSMIQNYAIEKNCESDADKPAISCGKFVMNEATMRAAASEVLCTHKGLCGAALESYLGTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247597_105506613300028334SeawaterNIQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQATMRAAASEVLCTHKALCGGALQTYLDTYFQKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247566_105648123300028335SeawaterMNIQLDDWHPGQHETLGASAYERVIPARFSTDDDDIFMRSMYNNYAIDKNCADKDEDPRPCGKFVMNESTMRAAASEVLCTHKGLCGAALESYLGTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247566_105746913300028335SeawaterMKFTTLVCLIGASQAITLWTTKGEIAYFEADQDEEQEAMNIQLDDWHPGQHGTLGGAAYERVIPARFTTDDDDIFMRSMYENYAIDKNCADKDDPPVPCGKFVMNQATMRAAASEVLCTHKALCGGALQTYLDTYFQKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0247566_108331113300028335SeawaterKFAIVALLGVASAKTTLYTTTGQVAYEEPEEMIQLDDWHPGQHEMLGASAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0304731_1011709313300028575MarineKFATLALLGAVSAKTTLYTTSGEIAYEEPEEMNLQINDWHPGQHEMLGDSAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKKEDPVPCGKFVMNESTMRAAASEVLCTHKGLCGTALESYLGTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0304731_1073775813300028575MarineELYFYKMKFAIAALIGAAAAKTTLWTTRGEIAYEEDDNETTNIMLDDWHPGQSGTLGAGEYERVTPARFAADSDDIFMRSMIQNYAIDKNCAGPDDPPKPCGKFTMNEVTMRAAASEVLCTHKGLCGGALQKYLDTYFTKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0304731_1113140313300028575MarineDDDEQAVQLNDWHPGQSGTLGKAEYKRVVTPRFSTDDDDIFMRSMIENYAIEDDGCPKSKDEEPDCVESPTGKFYMTEGTMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRGGKVEVIRSPQFMRFLASDQYMSLQ
Ga0304731_1133672513300028575MarineGIMRFTVAATLLLGYATARTTLWTTRGEIAYEESDDEDTNVQLDDFHPGQSGTLGASSYSRAVPARFSADSDDIFMRSMYNNYAIEKQNEDTGAPTGKFVMNKSTTRAAASEVLCTHKGLCGAKLQSYLGTYFDKAWGHFDVNKTGEVEIMKTPQFMRFLASDQYMSLQ
Ga0304731_1146230013300028575MarineAYEEPEDLVQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFIMNEATMRAAASEVLCTHKGLCGASLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0304731_1161917113300028575MarineKMKFALAALLGLAQARTTLFTTMGEVAYVEEDNESAAVQIDDWHPGLSGQLGAGAYERVTPARFSADSDDIFMRSMIENYAIDKNCAGKKEDPVPCGNFQMNKVTMRAAASEVLCTHKGLCGDKLNSYLATYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0307401_1011613913300030670MarineGIILIPKMKFAIAAFLGLAAARTTLYTTTGDIAFEQEDDDNMSLQLDDWHPGQSGTLGGAEYARVTTARFSADDDDIFMRSMIQNFAIEKNSGGDGPAVASGKFVMNAITMRAAAAEVLATHKGLTGDKLSAYLSTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASD
Ga0307401_1038219813300030670MarineMKFTIALATFLGLAQAKTTLWTTLGEIAYEEDDEEDTNLQIDDWHPGQSGTAGAGEYARATPARFSADSDDIFMRSMIQNYAIDKNCAGPDDAPAPCGKFTMNQVTMRAAASEVLCTHKGLCGGALQKYLDTYYAKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSL
Ga0307403_1057414313300030671MarineLIPKMKFAIAAFLGLAAARTTLYTTTGDIAFEQEDDDNMSLQLDDWHPGQSGTLGGAEYSRVTTARFSADDDDIFMRSMIQNFAIEKNSGGDGPAVASGKFVMNAITMRAAAAEVLATHKGLTGDKLSAYLSTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASD
Ga0307403_1078683013300030671MarineSAKTTLFRTNGEIAYEEADDSNVQIDDWHPGQSGTLGNAEYARVTPARFSTDDDDIFMRSMIQNYAIDKNCSGPDDAPTTCGKFTMNQATMRAAASEVLSTHKGLAGAALGTYLDTYFDKAWGHFDVNRTGEIEVIKSP
Ga0307398_1056956013300030699MarineANAITLWTTTGKIAFVEDEEPEAMNVQLDDWHPGQHGTLGALDYERVVTPRFAGDDDDIFMRSMISNYAIDKNCAGKDDPPASCGKFVMNEATMRAAASEVLCTHKGLCGGKLQDYLDTYFAKSWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307399_1036813613300030702MarineILIPKMKFAIAAFLGLAAARTTLYTTTGDIAFEQEDDDNMSLQLDDWHPGQSGTLGGAEYSRVTTARFSADDDDIFMRSMIQNFAIEKNSGGDGPAVASGKFVMNAITMRAAAAEVLATHKGLTGDKLQAYLSTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASD
Ga0307399_1041971413300030702MarineGIIHQTMKFALACFLGAANAITLWTVTGEIAYEEDDEPESMNVQINDWHPGQSGTLGGLEYARVTPARFSADDDDIFMRSMINNYAIDKNCSGPDDAPTTCGKFTMNEATMTAAASEVLCTHKGLCGAALSTYLQTYFGKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307399_1051689313300030702MarineEIMKFTLALIAAVTAHKVNDWHPGQHGTLGASDYERVIPARFSSDDDDIFMRSMIKSYAIDKNCAGPDDPPATCGKFVMNESTMRAAASEVLCTHKGLCGGKLQEYLDTYFAKSWGHFDVNRTGEIEVIKSPQFMRFIASDQYMSLQ
Ga0307400_1100376513300030709MarineSARTTLYRTNGEIAYEANDDLVQIEDWHPGQSGTLGNAEYARVTPARFSTDDDDIFMRSMIQNYAIDKNCSGPDDAPTTCGKFTMNQATMRAAASEVLSTHKGLAGAALGTYLDTYFDKAWGHFDVNRTGEIEVIKSP
Ga0308139_106777813300030720MarineLVALLGVVSAKTTLYRTNGEIAYEANDDLVQIDDWHPGQSGTLGNAEYARVTPARFASDDDDIFMRSMIQNYAIDKNCSGPDDAPTTCGKFTMNQATMRAAASEVLATHKGLAGAALGTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0308133_103286913300030721MarineMKFTIALACFLGYTQAITLWTTTGEIAYEESDEETENIQLNDWHAGQTGTLGNAEYARVVTPRFAADDDDIFMRSMIKNFAIEKSTEGTEEHPSVPTGKFVMNEATMRAAAQEVLCTHKGLCGAALSSYMNTYFGKSWGHFDVNKTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0308133_105896313300030721MarineKMKFALVALLGVVSAKTTLYRTNGEIAYEANDDLVQIDDWHPGQSGTLGNAEYARVTPARFASDDDDIFMRSMIQNYAIDKNCSGPDDAPTTCGKFTMNQSSMQAAASEVLCTHKAICGGALSAYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0308138_104235823300030724MarineFTAIVALLGAVSAKTTLFTTTGEIAYEQNDEDDVNLMIDDWHPGQSGTLGSGEYARVTPARFAADSDDIFMRSMINNYAIDKNCAGPDDAPAPCGKFTMNAITMRAAASEVLCTHKAICGAALQSYLSTYFDKAWGHFDVNKSGEIEVIKSPQFMRFLASDQYMSLQ
Ga0308138_106746013300030724MarineKFALVALLGVVSAKTTLYRTNGEIAYEANDDLVQIDDWHPGQSGTLGNAEYARVTPARFASDDDDIFMRSMIQNYAIDKNCSGPDDAPTTCGKFTMNQATMRAAASEVLATHKGLAGAALGTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0308128_103062613300030725MarineTQAITLWTTTGEIAYEESDEDTENIQLNDWHAGQTGTLGNAEYARVVTPRFAADDDDIFMRSMIKNFAIEKSTEGTEEHPSVPTGKFVMNEATMRAAAQEVLCTHKGLCGAALSSYMNTYFGKSWGHFDVNKTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0073988_1000929913300030780MarineLDDWHPGQHETLGASAYERVIPARFSTDDDDIFMRSMYKNYAIDKNCAGKDEDPMPCGKFVMNESTMRAAASEVLCTHKGLCGGKLVEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0073988_1001744313300030780MarineKMKFALAALLGLAQARTTLFTTMGEVAYVEEDESAALQIEDWHPGLSGQLGAGSYERVTPARFSGDSDDIFMRSMINNYAIDKDCAGKGEDPRPCGNFVMNKVTMRAAAGEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0073988_1225850813300030780MarineMKFATLAALLGVSQAITLWTTKGEIAYFEEDEDLPEAMNLQIDDWHPGQHEMLGAAAYERVTPARFSTDDDDIFMRSMIQNYAIDKNCEEDKKKDPYPCGKFVMNEATMRAAASEVLCTHKGLCGGQLQEYLDTYFAKAWGHFDVNRVGEIEVIKSPQFMRFLASDQYM
Ga0073988_1232211413300030780MarineKMKFALVALLGLANARTTLFTTQGEVAYVEEDESAALQIDDWHPGLSGQLGAGSYERVTPARFSADSDDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAASEVLATHKGLTGDKLNSYLATYFDKAWGHFDVNQTGEIEVGKSPQFMRFLASDQYMSLQ
Ga0073988_1232837913300030780MarineMKFALACLLGAANAITIWTTTGEIAYQEDDEPEAMNIQIDDWHPGQHGTLGASEYTRVVPARFSTDDDDIFMRSMIDNYAIEKNCSGPDDPPTTCGKFVQNEATMRAAASEVLCTHKGLCGAKLQEYLDTYFAKAWGHFDVNRVGEIEVIKSPQFMRFLASDQYMSLQ
Ga0073988_1236345013300030780MarineGIIMKFAIAALLGAVSAKTTLYNTRGEVAYEEPEEMVQLDDWHPGQHEMLGASAYERVTPARFSSDDDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGAALGGYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0073982_1170055813300030781MarineLLKMKFALAALLGLAQARTTLFTTMGEVAYVEDDESAALQIDDWHPGLSGQLGAGAYERAVPARFSADSDDIFMRSMLENYAIDKNCAGKDEDPRPCGKFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0073982_1174949513300030781MarineIILLKMKFALAALLGLAQARTTLFTTMGEVAYVEDDESAAVQIDDWHPGLSGQLGAGAYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDEDPRPCGNFTMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVDVIKSPQFMRFLASDQYMSLQ
Ga0073987_1118835513300030912MarineLLKMKFALVALLGYASARTTLFTTMGEVAYVEEDESAALQIDDWHPGLSGQLGAGAYERQTPARFSADSDDIFMRSMIENYAIDKNCAGKDEDPRPCGKFVMNKVTMRAAASEVLATHKGLTGDKLNSYLSTYFDKAWAHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0073987_1122614513300030912MarineGIIMKFAIAALLGAVSAKTTLYTVSGEVAYEEPEEMVQLDDWHPGQHEMLGAAAYERVTPARFSSDDDDIFMRSMIQNYAIDKDCAGKDEDPRPCGKFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0073987_1122877613300030912MarineLLKMKFALAALLGLAQARTTLFTTMGEVAYVEDDESAAVQIDDWHPGLSGQLGAGAYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDEDPRPCGNFTMNKVTMRAAASEVLCTHKGLCGDKLNAYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0073989_1344766213300031062MarineLLKMKFALVALLGLAQARTTLYTTQGEVAYVEDDESAALQIEDWHPGLSGQLGAGAYERVTPARFSGDSDDIFMRSMIQNYAIDKNCAGKDEDPVPCGKFVMNEATMRAAASEVLCTHKGLCGAQLQEYLDTYFAKAWGHFDVNRVGEIEVIKSPQFMRFLASDQYMSLQ
Ga0073989_1358330413300031062MarineTKGEIAYFEDDENTDAMNLQLDDWHPGQHGTLGGAAYERVYPARFQTDDDDIFMRSMYENYAIDKNCAGKDDPPAPCGKFVMNESTMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0073989_1360585413300031062MarineAALQIDDWHPGLSGQLGSGAYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLATYFDKAFGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0073989_1360806513300031062MarineLLKMKFALAALLGLAQARTTLFTTMGEVAYVEDDESSAVQIDDWHPGLSGQLGAGAYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDDPPAPCGKFVMNKVTMRAAASEVLCTHKGLCGDKLNSYLGTYFDKAWGHFDVNQTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0307388_1056503413300031522MarineGLPPNESYMCCYTAASFGLPVELAVDEHSEPHSCGVASTKTTLYTTNGNIAYEEPEDLLQLDDWHPGQHEMLGNAAYERVTPARFSADSDDIFMRSMIQNYAIDKNCAGKDDDPAPCGKFVMNEATMRAAASEVLCTHKGLCGASLGSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASD
Ga0307388_1072141413300031522MarineTLWTTTGEIAYYEQDEEEAGDAMNLQLDDWHPGQHGTLGGSEYDRVIPDRFSTDSDDIFMRSMYNNYAIDKNCAGKDEDPMPCGKFVMNESTMRAAASEVLCTHKGLCGGKLGEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0308149_103209113300031542MarineMKFAILALIGSVAAKTTLYRTNGEIAYEQEDEENLMIEDWHPGQSGTLGGAEYARTTPARFSADSDDIFMRSMIQNYAIDKNCAGKDDPPAPCGTFTMNQATMRAAASEVLATHKGLAGAALQTYLDTYFSKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0308142_104438713300031556MarineIIIMKFAILALIGAVAAKTTLYRTNGEIAYEQEDEENLMIEDWHPGQSGTLGGAEYARTTPARFSADSDDIFMRSMIQNFAIDKNCAGPDDPPASCGKFTMNPVTMRAAASEVLATHKGLTGAALQTYLTTYFEKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0308142_107246713300031556MarineMKFALACLLGAANAMTIYTTTGEVAFEENDEPEAMNLQLDDWHPGQHGTLGASEYVRVVPARFSSDDDDIFMRSMINNYAIDKNCAGKDDPPAPCGTFTMNESTMRAAASEVLCTHKGLCGAALETYLGTYFAKSWGHFDVNKTG
Ga0308148_103645113300031557MarineLLANMKFAIFALLGFTAARTTLYNMEGQITYMTEDDEVNLQLDDWHPGQSGTSGAAEYARVTPARFSADSDDIFMRSMIQNYAIDKNCAGSDDPPASCGKFTMNPVTMRAAASEVLATHKGLTGAALQTYLTTYFEKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0308134_109535713300031579MarineKFTAIVALLGAVSAKTTLFTTTGEIAYEQNDEDDVNLMIDDWHPGQSGTLGSGEYARVTPARFAADSDDIFMRSMINNYAIDKNCAGPDDAPAPCGKFTMNAITMRAAASEVLCTHKAICGAALQSYLSTYFDKAWGHFDVNKSGEIEVIKSPQFMRFLASDQYMSLQ
Ga0308134_115230813300031579MarineKMKFALVALLGVVSAKTTLYRTNGEIAYEANDDLVQIDDWHPGQSGTLGNAEYARVTPARFASDDDDIFMRSMIQNYAIDKNCSGPDDAPTTCGKFTMNQATMRAAASEVLATHKGLAGAALGTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLALDQYMSLQ
Ga0308134_116405713300031579MarineMKFALAAALLGAANAITLWTVKGEIAYEEDEEPESMNVQLDDWHPGQHGTLGNAEYSRVVPARFSTDDDDIFMRSMINNYAIDKNCAGKDDAPAPCGKFTMNEATMRAAASEVLCTHKAICGGALQTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFIASD
Ga0302126_1012383913300031622MarineMTKLKHLKSITFGSFYNNLINGMKFTAIVALLGAVSAKTTLFTTTGEIAYEQNDEDDVNLMIDDWHPGQSGTLGSGEYARVTPARFAADSDDIFMRSMINNYAIDKNCAGPDDAPAPCGKFTMNAITMRAAASEVLCTHKAICGAALQSYLSTYFDKAWGHFDVNKSGEIEVIKSPQFMRFLASDQYMSLQ
Ga0302126_1023394913300031622MarineMKFALVALLGVVSAKTTLYRTNGEIAYEANDDLVQIDDWHPGQSGTLGNAEYARVTPARFASDDDDIFMRSMIQNYAIDKNCSGPDDAPTTCGKFTMNQATMRAAASEVLATHKGLAGAALGTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0302121_1007911513300031626MarinePKTPKPQKCENILETLFVQLKITKLKHLKSITFGSFYNNLINGMKFTAIVALLGAVSAKTTLFTTTGEIAYEQNDEDDVNLMIDDWHPGQSGTLGSGEYARVTPARFAADSDDIFMRSMINNYAIDKNCAGPDDAPAPCGKFTMNAITMRAAASEVLCTHKAICGAALQSYLSTYFDKAWGHFDVNKSGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307393_109890313300031674MarineIHQTMKFALACFLGAANAITLWTVTGEIAYEEDDEPESMNVQINDWHPGQSGTLGGLEYARVTPARFSADDDDIFMRSMINNYAIDKNCSGPDDAPTTCGKFTMNEATMTAAASEVLCTHKGLCGAALSTYLQTYFGKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307385_1021818613300031709MarineLKMKFALAALLGLAQARTTLFTTQGEVAYVEDDESAAVQIDDWHPGLSGQLGAGTYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKSWGHFDVNQTGEIEVGKSPQFMRFLASDQYMSLQ
Ga0307385_1036513413300031709MarineFITKMKFTLAIAALLSYTQAITLWTINGEIAYEESDEEEQNIQLDDYHPGQTGTLGAGEYSRVVPARFASDSDDIFMRSMINSYAIEGASKDGVPTGNFYMNEATMRAAASEVLCTHKALCGGALSKYLDTYFAKAWGHFDVNRSGSVEVIRSPQFMRFLSSDQYMSL
Ga0307385_1036949013300031709MarineLKMKFALAALLGLAQARTTLFTTQGEVAYVEEDDVQAVQIDDWHPGLSGQMGAGSYERVTPARFSADSDDIFMRSMIGNYAIDKNCAGKDEDARPCGNFVMNKVTMRAAAGEVLATHKGLTGDKLNSYLGTYFDKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307385_1038442713300031709MarineTTGEIAYYEQDEEEAGDAMNLQLDDWHPGQHGTLGGSEYERVIPDRFSTDSDDIFMRSMYNNYAIDKNCAGKDEDPMPCGKFVMNESTMRAAASEVLCTHKGLCGGKLGEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307386_1039066613300031710MarineILTKMKFATLAALIGVSQAITLWTTTGEIAYYEQDEEEAGDAMNLQLDDWHPGQHGTLGGSEYERVIPDRFSTDSDDIFMRSMYNNYAIDKNCAGKDEDPMPCGKFVMNESTMRAAASEVLCTHKGLCGGKLGEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307386_1047612223300031710MarineYTLKMKFALAALLGLAQARTTLFTTQGEVAYVEDDESAAVQIDDWHPGLSGQLGAGTYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKSWGHFDVNQTGEIEVGKSPQFMRFLASDQYMSLQ
Ga0307386_1048711613300031710MarineMDEDDSTNVQLNDWHAGQTGTLGNADYERVVPSRFASDDDDIFMRSMVRNYAIEKGTKEEEDKPSVPTGKFVMNESTTRAAASEVVCTHKGLCGANLTKYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307386_1057965913300031710MarineGMKFTTLACLLASAEAITLWTTKGEIAYYEDDEETESMNVQLDDWHPGQHGTLGGAAYERVYPARFQTDSDDIFMRSMYENYAIDKNCAGKDDPPAPCGNFVMNESTMRAAASEVLCTHKGLCGGALVTYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0307386_1065952013300031710MarineKIMKFAIVALLGAVSAKTTLYTTTGQIAYEEPEEMNLQINDWHPGQHEMLGAAEYARVTPARFSADDDDIFMRSMIQNYAIDKNCAGKDDPPVPCGKFVMNESTMRAAASEVLCTHKGLCGGALSAYLDTYFAKSWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307381_1025727813300031725MarineALAALLGLAQARTTLFTTQGEVAYVEEDDVQAVQIDDWHPGLSGQMGAGSYERVTPARFSGDSDDIFMRSMISNYAIDKDCAGKGEDPRPCGNFVMNKVTMRAAAGEVLATHKGLTGDKLNSYLGTYFDKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307391_1037783213300031729MarineMKFAIVALLGAVSAKTTLFRTNGEIAYEEADDSNVQIDDWHPGQSGTLGNAEYARVTPARFSTDDDDIFMRSMIQNYAIDKNCSGPDDAPTTCGKFTMNQATMRAAASEVLSTHKGLAGAALGTYLDTYFDKAWGHFDVNRTGEIEVIKSP
Ga0307397_1039579613300031734MarineFNGIMKFALAAFLGTANAITLWTTTGKIAFVEDEEPEAMNVQLDDWHPGQHGTLGALDYERVIPARFSADSDDIFMRSMIGNYAIDKNCAGKDDPPASCGKFVMNEATMRAAASEVLCTHKGLCGAKLQDYLDTYFAKSWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307397_1040157323300031734MarineMENDDEESTNVQLDDWHPGQHGTLGAGEYERVTPARFANDDDDIFMRSMINNYAIDKNCAGKDDPPASCGNFTMNEATMRAAASEVLCTHKGLCAAALGAYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307384_1036173823300031738MarineMKFALAALLGLAQARTTLFTTQGEVAYVEDDESAAVQIDDWHPGLSGQLGAGTYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKSWGHFDVNQTGEIEVGKSPQFMRFLASDQYMSLQ
Ga0307384_1036836523300031738MarineKFAIVALLGAVSAKTTLYTTTGQIAYEEPEEMNLQINDWHPGQHEMLGAAEYARVTPARFSADDDDIFMRSMIQNYAIDKNCAGKDDPPVPCGKFVMNESTMRAAASEVLCTHKGLCGGALSAYLDTYFAKSWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307384_1045880713300031738MarineMKFAIAALLGAAAARTTLYTTTGAIAYEEPEEMNLQMEDWHPGQHGTLGGAAYERVIPARFSGDSDDIFMRSMLNNYAIDKNCAGKDDPPASCGNFIMNAVTMRAAASEVLCTHKGLCGAALESYLGTYFQKSWGHFDVNQTGEIEVIKTPQFMRFLASDQYMSLQ
Ga0307384_1052767013300031738MarineKMKFAIAALLGLAAARTTLFTTQGQVAYVEEDNESAALQLDDWHPGQHETLGASAYERVTPERFSGDSDDIFMRSMIQNYAIEKNCAAPKADPVACGNFVMNKVTMRAAAGEVLATHKGLTGDKLQSYLATYFDKSFGHFDVNQTGEIEVMKAPQFMRFLASDQYMSLQ
Ga0307384_1059212113300031738MarineMKFAILAAAVAAKTTLYTTRGEIAYEEPVDLLQLDDWHPGQHEMLGAAAYERVTPARFSADEDDIFMRSMIQNYAIEKNCAADIKKDDPIACGNFIMNASTMRAAASEVLCTHKGLCGGALNTYLGTYFDKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307383_1040480513300031739MarineMKFFAIAALLGAISARTVLYNNFGEVTYIQEEGEEINLQLDDFHPGQGGTLGASSYSRVIPGRFSADSDDIFMRSMYNNYAIERADGDGAPTGTFVMNAVTMRAAAGEVLKTHKGLDGAKLQKYLDTYFDKAWGHFDVNKSGAIEISKSP
Ga0307383_1041357813300031739MarineRNYTLKMKFALAALLGLAQARTTLFTTQGEVAYVEDDESAAVQIDDWHPGLSGQLGAGTYERVTPARFSGDSDDIFMRSMINNYAIDKNCAGKDDPPAPCGNFVMNKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKSWGHFDVNQTGEIEVGKSPQFMRFLASDQYMSLQ
Ga0307383_1044629723300031739MarineFIIIMKFAILALAGVVSARTTLFRTNGEIAYEEEEESNLQIDDFHPGQSGTLGGAEYSRVMPARFAADSDDIFMRSMIGNYAIEKANDDGAPTGAFVMNASTMRAAASEVLCTHKALCGAALTAYLGTYFDKAWGHFDVNKTGAIEVIKSPQFMRFLASDQYMSLQ
Ga0307383_1065875313300031739MarineKFAILALLGVVSAKTTLYTTQGEIAYEQNDDLVQIDDWHPGLSGQLGAGEYARVTPARFATDDDDIFMRSMINNYAIEKDADGAPSGNFIMNESTMRAAASEVLCTHKGLCGGKLGEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307383_1065989413300031739MarineNGMKFTALVALIGATQAITLWTTTGQIAYFENDDEPEAMNVQLDDWHPGQHEMLGASAYERVTPARFSADSDDIFMRSMIQNYAIDKNCAGKDDDPAPCGKFVMNEATMRAAASEVLCTHKGLCGASLGSYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0307383_1069505413300031739MarineMKFALAAFLGVANAITLWTVTGEIAYEEDDEPETMNLQLDDYHPGQHGTLGAAEYARVIPAFFSSDDDDIFMRSMYNNYAIEKADGDTGAPLGKFVMNESTMRAAASEVLCTHKGLCGAKLQDYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLSSDQYMSLQ
Ga0307382_1037584323300031743MarineKMKFALAALLGLAQARTTLFTTQGEVAYVEEDDVQAVQIDDWHPGLSGQMGAGSYERVTPARFSGDSDDIFMRSMISNYAIDKDCAGKGEDPRPCGNFVMNKVTMRAAAGEVLATHKGLTGDKLNSYLGTYFDKAWGHFDVNQTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307382_1040013113300031743MarineINGMKFTTLACLLASAEAITLWTTKGEIAYYEDDEETESMNVQLDDWHPGQHGTLGGAAYERVYPARFQTDSDDIFMRSMYENYAIDKNCAGKDDPPAPCGNFVMNESTMRAAASEVLCTHKGLCGGALVTYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0307382_1048442413300031743MarineMKFAILALLGVASTKTTLYTTNGNIAYEEPEDLLQLDDWHPGQHEMLGASAYERVTPARFSADSDDIFMRSMIQNYAIDKNCAGKDDDPAPCGKFVMNEATMRAAASEVLCTHKGLCGASLGSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307382_1053870413300031743MarineEQKIMKFAIVALLGAVSAKTTLYTTTGQIAYEEPEEMNLQINDWHPGQHEMLGAAEYARVTPARFSADDDDIFMRSMIQNYAIDKNCSGPDDAPSTCGKFTMNQATMRAAASEVLCTHKAICGPALQAYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307382_1054259513300031743MarineILTKMKFATLAALIGVSQAITLWTTTGEIAYYEQDEEEAGDAMNLQLDDWHPGQHGTLGGSEYERVIPDRFSTDSDDIFMRSMYNNYAIDKNCAGADEDPMPCGKFVMNESTMRAAASEVLCTHKGLCGGKLGEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0307404_1036380413300031752MarineMKFALVALLSVSARTTLYRTNGEIAYEANDDLVQIEDWHPGQSGTLGNAEYARVTPARFSTDDDDIFMRSMIQNYAIDKNCSGPDDAPTTCGKFTMNQATMRAAASEVLSTHKGLAGAALGTYLDTYFDKAWGHFDVNRTGEIEVIKSP
Ga0314668_1059733013300032481SeawaterFNGIIMKFAILALLGVASTKTTLYTTSGEIAYEEPEDLVQLDDWHPGQHGTLGAAEYERVTPARFASDSDDIFMRSMIENYAIDKNCAGKDEDPVPCGNFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0314689_1044804213300032518SeawaterIILTTMKFATLAALIGATQAITLWTTTGQIAYFEADDQDTDAMNLQLDDWHPGQHGTLGASEYERVIPGRFSTDDDDIFMRSMYDNYAIDKNCAGKDDPPAPCGNFVMNQSTMRAAASEVLCTHKGLCGAALGTYLDTYFAKAWGHFDVNRTGEIEIIKSPQFMRFLASDQYMSLQ
Ga0314689_1051871513300032518SeawaterIMKFAILALLGVASTKTTLYTTSGEIAYEEPEDLVQLDDWHPGQHGTLGAAEYERVTPARFASDSDDIFMRSMIENYAIDKNCAGKDEDPVPCGNFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0314680_1063343813300032521SeawaterLTTMKFATLAALIGATQAITLWTTTGQIAYFEADDQDTDAMNLQLDDWHPGQHGTLGASEYERVIPGRFSTDDDDIFMRSMYDNYAIDKNCAGKDDPPAPCGNFVMNQSTMRAAASEVLCTHKGLCGAALGTYLDTYFAKAWGHFDVNRTGEIEIIKSPQFMRFLASDQYMSLQ
Ga0314680_1092817613300032521SeawaterGFRLLKVVYRGLALLGVASTKTTLYTTSGEIAYEEPEDLVQLDDWHPGQHGTLGAAEYERVTPARFASDSDDIFMRSMIENYAIDKNCAGKDEDPVPCGNFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0314682_1054056413300032540SeawaterIIMKFAILALLGVASTKTTLYTTSGEIAYEEPEDLVQLDDWHPGQHGTLGAAEYERVTPARFASDSDDIFMRSMIENYAIDKNCAGKDEDPVPCGNFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0314674_1055724913300032615SeawaterKFAILALLGVASTKTTLYTTSGEIAYEEPEDLVQLDDWHPGQHGTLGAAEYERVTPARFASDSDDIFMRSMIENYAIDKNCAGKDEDPVPCGNFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0314685_1057005313300032651SeawaterMKFAILALLGVASTKTTLYTTSGEIAYEEPEDLVQLDDWHPGQHGTLGAAEYERVTPARFASDSDDIFMRSMIENYAIDKNCAGKDEDPVPCGNFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0314687_1060341313300032707SeawaterKMKFALVALLGLAQARTTLFTTMGEVAYVEEDESAAVQIDDWHPGQSGTLGAGTYERTTPARFSGDSDDIFMRSMIGNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLATHKGLTGDKLNSYLGTYFDKAWGHFDVNQTGEIEVAKSPQFMRFLASDQYMSLQ
Ga0314686_1063915013300032714SeawaterLVQLDDWHPGQHGTLGAAEYERVTPARFASDSDDIFMRSMIENYAIDKNCAGKDEDPVPCGNFVMNEATMRAAASEVLCTHKGLCGGSLQSYLGTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0314695_135202113300032724SeawaterTLKMKFALVALLGLAQARTTLFTTMGEVAYVEEDESAAVQIDDWHPGQSGTLGAGTYERTTPARFSGDSDDIFMRSMIGNYAIDKNCAGKDEDPRPCGNFVMNKVTMRAAAGEVLATHKGLTGDKLNSYLGTYFDKAWGHFDVNQTGEIEVAKSPQFMRFLASDQYMSLQ
Ga0314695_142224513300032724SeawaterGIIMKFAILALLGVASTKTTLYTTSGEIAYEEPEDLVQLDDWHPGQHGTLGAAEYERVTPARFASDSDDIFMRSMIENYAIDKNCAGKDEDPVPCGNFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSL
Ga0314710_1048862413300032742SeawaterSTKTTLYTTSGEIAYEEPEDLVQLDDWHPGQHGTLGAAEYERVTPARFASDSDDIFMRSMIENYAIDKNCAGKDEDPVPCGNFVMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0314701_1032643813300032746SeawaterILTTMKFATLAALIGATQAITLWTTTGQIAYFEADDQDTDAMNLQLDDWHPGQHGTLGASEYERVIPGRFSTDDDDIFMRSMYDNYAIDKNCAGKDDPPAPCGNFVMNQSTMRAAASEVLCTHKGLCGAALGTYLDTYFAKAWGHFDVNRTGEIEIIKSPQFMRFLASDQYMSLQ
Ga0314708_1042021723300032750SeawaterGIIMKFAILALLGVASTKTTLYTTSGEIAYEEPEDLVQLDDWHPGQHGTLGAAEYERVTPARFASDSDDIFMRSMIENYAIDKNCAGKDEDPVPCGNFVMNEATMRAAASEVLCTHKGLCGGSLQSYLGTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0314694_1028219913300032751SeawaterMSNMCLVDGVGGVVRLSDGATLAALIGATQAITLWTTTGQIAYFEADDQDTDAMNLQLDDWHPGQHGTLGASEYERVIPGRFSTDDDDIFMRSMYDNYAIDKNCAGKDDPPAPCGNFVMNQSTMRAAASEVLCTHKGLCGAALGTYLDTYFAKAWGHFDVNRTGEIEIIKSPQFMRFLASDQYMSLQ
Ga0314700_1042321213300032752SeawaterELIILTTMKFATLAALIGATQAITLWTTTGQIAYFEADDQDTDAMNLQLDDWHPGQHGTLGASEYERVIPGRFSTDDDDIFMRSMYDNYAIDKNCAGKDDPPAPCGNFVMNQSTMRAAASEVLCTHKGLCGAALGTYLDTYFAKAWGHFDVNRTGEIEIIKSPQFMRFLASDQYMSLQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.