Scaffold Ga0187736_159858

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0187736_159858

Scaffold Ga0187736_159858

Overview

Basic Information
Taxon OID	3300030697 Open in IMG/M
Scaffold ID	Ga0187736_159858 Open in IMG/M
Source Dataset Name	Metatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium from Pennsylvania, USA - 11_T1F_StrKB8 developmental time series (Eukaryote Community Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	588
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Upside-down Jellyfish Cassiopea Xamachana Infected With Symbiotic Dinoflagellate Symbiodinium From Hawaii, Usa

Source Dataset Sampling Location
Location Name	USA: Pennsylvania
Coordinates	Lat. (^o)	40.7982	Long. (^o)	-77.8599	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004725	Metagenome / Metatranscriptome	426	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187736_1598581	F004725	N/A	DLRSLEVKPTFQFSAAIVPMATSAPLLGKQGKAAHSKASIFYGADEYLEELKKKYEHDHEIAALKNALPGEGDPNAAGVAQSNDKMLSVQKNDENRSLKTNRLFPTPNKPDPMPQNLAFLFTKITPEQMIYMWNVLTAIFFTQVLMVIGYCAALACFPDYWWTCTLCFGLPFSYIAIQNIYIDHDVMHGATFPVY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.