| Basic Information | |
|---|---|
| Taxon OID | 3300030658 Open in IMG/M |
| Scaffold ID | Ga0187760_1026334 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium under thermal stress from Pennsylvania, USA - 36_T1F_3212EL1 (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 595 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Upside-down Jellyfish Cassiopea Xamachana Infected With Symbiotic Dinoflagellate Symbiodinium From Hawaii, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Pennsylvania | |||||||
| Coordinates | Lat. (o) | 40.7982 | Long. (o) | -77.8599 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054545 | Metatranscriptome | 139 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0187760_10263341 | F054545 | N/A | PLGDPVSKVRAGWQCTAYITESARPIICGGIRAEGPSVADMQQAGEEGDGVAPEMRGGGYKGGGPQPEAGVMDMVSTTGVEVMTEVVTEASVGEAHGLLVCYDGTLRGWGYNRQKQAIGDETDDTFVKPQAVDDVPFDTYKGLSVAVGGAQSYAILQQRHP |
| ⦗Top⦘ |