| Basic Information | |
|---|---|
| Taxon OID | 3300030513 Open in IMG/M |
| Scaffold ID | Ga0268242_1000027 Open in IMG/M |
| Source Dataset Name | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 20245 |
| Total Scaffold Genes | 19 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (73.68%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Agave Microbial Communities From California, Usa, And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mexico: San Luis Potosi | |||||||
| Coordinates | Lat. (o) | 21.766 | Long. (o) | -100.163 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046937 | Metagenome / Metatranscriptome | 150 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0268242_10000276 | F046937 | AGGAG | MSSGGKCPMGKHPWLATMLVVAFLLCVVAKWLGWLY |
| ⦗Top⦘ |