NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046937

Metagenome / Metatranscriptome Family F046937

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046937
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 35 residues
Representative Sequence MSEHGKCPMGKHPWLATFFVLAFLLVFLAHKLGLL
Number of Associated Samples 93
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 60.00 %
% of genes near scaffold ends (potentially truncated) 8.00 %
% of genes from short scaffolds (< 2000 bps) 76.00 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(12.667 % of family members)
Environment Ontology (ENVO) Unclassified
(23.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.667 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 30.16%    β-sheet: 0.00%    Coil/Unstructured: 69.84%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF00155Aminotran_1_2 15.33
PF13432TPR_16 15.33
PF13424TPR_12 9.33
PF13847Methyltransf_31 4.67
PF14559TPR_19 4.67
PF13519VWA_2 2.67
PF13414TPR_11 2.00
PF01464SLT 2.00
PF13360PQQ_2 1.33
PF08545ACP_syn_III 1.33
PF13492GAF_3 0.67
PF07927HicA_toxin 0.67
PF01252Peptidase_A8 0.67
PF13450NAD_binding_8 0.67
PF07719TPR_2 0.67
PF09723Zn-ribbon_8 0.67
PF00348polyprenyl_synt 0.67
PF12773DZR 0.67
PF13361UvrD_C 0.67
PF04655APH_6_hur 0.67
PF13620CarboxypepD_reg 0.67
PF13462Thioredoxin_4 0.67
PF00092VWA 0.67
PF01790LGT 0.67
PF00072Response_reg 0.67
PF00550PP-binding 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG0597Lipoprotein signal peptidaseCell wall/membrane/envelope biogenesis [M] 1.33
COG0142Geranylgeranyl pyrophosphate synthaseCoenzyme transport and metabolism [H] 0.67
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.67
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.67
COG3570Streptomycin 6-kinaseDefense mechanisms [V] 0.67

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.00 %
UnclassifiedrootN/A24.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000828|JGI12467J12023_1203259All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300005554|Ga0066661_10122666All Organisms → cellular organisms → Bacteria1572Open in IMG/M
3300005560|Ga0066670_10500567All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300005562|Ga0058697_10280984All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium787Open in IMG/M
3300005562|Ga0058697_10800225All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300005566|Ga0066693_10218993All Organisms → cellular organisms → Bacteria → Acidobacteria746Open in IMG/M
3300005607|Ga0070740_10000619All Organisms → cellular organisms → Bacteria67670Open in IMG/M
3300005616|Ga0068852_100630542All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales1078Open in IMG/M
3300005985|Ga0081539_10000230All Organisms → cellular organisms → Bacteria131269Open in IMG/M
3300006032|Ga0066696_10956934Not Available545Open in IMG/M
3300006794|Ga0066658_10498287Not Available663Open in IMG/M
3300006800|Ga0066660_10485140Not Available1038Open in IMG/M
3300006918|Ga0079216_10661894All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300009177|Ga0105248_13442455All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300009789|Ga0126307_10621776All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium872Open in IMG/M
3300009789|Ga0126307_11025312All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300010036|Ga0126305_10330394All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes995Open in IMG/M
3300010037|Ga0126304_10043869All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2690Open in IMG/M
3300010039|Ga0126309_10589416All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300010039|Ga0126309_11229806All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300010040|Ga0126308_10871883All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300010040|Ga0126308_10946772All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300010041|Ga0126312_10420862All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes951Open in IMG/M
3300010042|Ga0126314_11105009All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300010045|Ga0126311_10000352All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes21944Open in IMG/M
3300010045|Ga0126311_10320348All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300010045|Ga0126311_10541350All Organisms → cellular organisms → Bacteria → Acidobacteria916Open in IMG/M
3300010045|Ga0126311_11640435All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300010166|Ga0126306_10031889All Organisms → Viruses → Predicted Viral3568Open in IMG/M
3300010166|Ga0126306_10200548All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1506Open in IMG/M
3300010166|Ga0126306_11024666All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300012043|Ga0136631_10140695Not Available929Open in IMG/M
3300012045|Ga0136623_10444432Not Available548Open in IMG/M
3300012093|Ga0136632_10020972All Organisms → cellular organisms → Bacteria2901Open in IMG/M
3300012093|Ga0136632_10124510All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300012093|Ga0136632_10147205Not Available1083Open in IMG/M
3300012093|Ga0136632_10150663Not Available1070Open in IMG/M
3300012186|Ga0136620_10193452Not Available905Open in IMG/M
3300012187|Ga0136622_10028791All Organisms → cellular organisms → Bacteria → Acidobacteria2370Open in IMG/M
3300012187|Ga0136622_10339853Not Available630Open in IMG/M
3300012188|Ga0136618_10051129All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia1829Open in IMG/M
3300012678|Ga0136615_10507172Not Available518Open in IMG/M
3300012684|Ga0136614_10343229All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300014488|Ga0182001_10000033All Organisms → cellular organisms → Bacteria32773Open in IMG/M
3300014488|Ga0182001_10000445All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes8418Open in IMG/M
3300014488|Ga0182001_10014058All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1776Open in IMG/M
3300014488|Ga0182001_10088434Not Available933Open in IMG/M
3300014488|Ga0182001_10112304All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes867Open in IMG/M
3300014488|Ga0182001_10548063All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300014488|Ga0182001_10625988All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300015158|Ga0167622_1064121Not Available613Open in IMG/M
3300017787|Ga0183260_10067153All Organisms → cellular organisms → Bacteria → Acidobacteria2635Open in IMG/M
3300017789|Ga0136617_10221541Not Available1586Open in IMG/M
3300017789|Ga0136617_11276060All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300018431|Ga0066655_10608368All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300018431|Ga0066655_10686269All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300018432|Ga0190275_11513188Not Available749Open in IMG/M
3300018465|Ga0190269_10074158All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1613Open in IMG/M
3300018465|Ga0190269_10405647All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes845Open in IMG/M
3300018465|Ga0190269_10704593All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300018466|Ga0190268_10730903Not Available734Open in IMG/M
3300018466|Ga0190268_11046924All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300018466|Ga0190268_11248254All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300018468|Ga0066662_10026056All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes3383Open in IMG/M
3300018468|Ga0066662_10602301Not Available1028Open in IMG/M
3300018468|Ga0066662_11038924Not Available814Open in IMG/M
3300018468|Ga0066662_11325738Not Available739Open in IMG/M
3300018468|Ga0066662_11986512All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300018890|Ga0193595_1045418All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1456Open in IMG/M
3300018892|Ga0193607_1000752All Organisms → cellular organisms → Bacteria15671Open in IMG/M
3300018918|Ga0193616_1107135All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes782Open in IMG/M
3300018920|Ga0190273_10547538All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300018920|Ga0190273_11081763Not Available670Open in IMG/M
3300018920|Ga0190273_11131568All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300018920|Ga0190273_11386857All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300018939|Ga0193593_1001390All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes6907Open in IMG/M
3300018946|Ga0193599_1003040All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes6858Open in IMG/M
3300019142|Ga0193597_1000118All Organisms → cellular organisms → Bacteria → Acidobacteria56714Open in IMG/M
3300019377|Ga0190264_12340332Not Available503Open in IMG/M
3300019767|Ga0190267_10392446All Organisms → cellular organisms → Bacteria → Acidobacteria770Open in IMG/M
3300019767|Ga0190267_10987983Not Available589Open in IMG/M
3300019767|Ga0190267_11241922All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300019767|Ga0190267_11367411Not Available534Open in IMG/M
3300019767|Ga0190267_11523347Not Available517Open in IMG/M
3300019767|Ga0190267_11550292All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300019767|Ga0190267_11627847All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300020146|Ga0196977_1000180All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes39865Open in IMG/M
3300020146|Ga0196977_1044983All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1056Open in IMG/M
3300020146|Ga0196977_1048908All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300020154|Ga0196965_1044281Not Available1164Open in IMG/M
3300020202|Ga0196964_10025536All Organisms → cellular organisms → Bacteria → Acidobacteria2439Open in IMG/M
3300020202|Ga0196964_10206898All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales909Open in IMG/M
3300020202|Ga0196964_10227079All Organisms → cellular organisms → Bacteria → Acidobacteria870Open in IMG/M
3300020215|Ga0196963_10028780All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2354Open in IMG/M
3300020215|Ga0196963_10238868Not Available791Open in IMG/M
3300020215|Ga0196963_10294281All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes715Open in IMG/M
3300021067|Ga0196978_1000004All Organisms → cellular organisms → Bacteria561312Open in IMG/M
3300021362|Ga0213882_10377371Not Available597Open in IMG/M
3300021374|Ga0213881_10268513All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300021384|Ga0213876_10000479All Organisms → cellular organisms → Bacteria → Acidobacteria31639Open in IMG/M
3300021384|Ga0213876_10002219All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes11456Open in IMG/M
3300021445|Ga0182009_10243479Not Available890Open in IMG/M
3300024430|Ga0196962_10078835All Organisms → cellular organisms → Bacteria → Acidobacteria1009Open in IMG/M
3300026142|Ga0207698_11856307All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300026312|Ga0209153_1000614All Organisms → cellular organisms → Bacteria15298Open in IMG/M
3300026312|Ga0209153_1313299Not Available504Open in IMG/M
3300026325|Ga0209152_10183418Not Available785Open in IMG/M
3300026552|Ga0209577_10356066Not Available1075Open in IMG/M
3300026552|Ga0209577_10430043Not Available933Open in IMG/M
3300027618|Ga0208736_1167518Not Available507Open in IMG/M
3300027706|Ga0209581_1001113All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes35423Open in IMG/M
3300027750|Ga0209461_10004046All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2436Open in IMG/M
3300027766|Ga0209796_10252653All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300030510|Ga0268243_1052840All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes882Open in IMG/M
3300030513|Ga0268242_1000027All Organisms → cellular organisms → Bacteria → Acidobacteria20245Open in IMG/M
3300030513|Ga0268242_1004788All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2015Open in IMG/M
3300031731|Ga0307405_11214944All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300031740|Ga0307468_100228234All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1288Open in IMG/M
3300031852|Ga0307410_10610671All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes911Open in IMG/M
3300031901|Ga0307406_11952211All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300031995|Ga0307409_101233600All Organisms → cellular organisms → Bacteria → Acidobacteria772Open in IMG/M
3300032126|Ga0307415_100541082All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1026Open in IMG/M
3300034000|Ga0334918_014115Not Available1091Open in IMG/M
3300034000|Ga0334918_044632All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300034002|Ga0334920_000054All Organisms → cellular organisms → Bacteria → Acidobacteria42502Open in IMG/M
3300034005|Ga0334930_016575All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1128Open in IMG/M
3300034005|Ga0334930_051026Not Available699Open in IMG/M
3300034005|Ga0334930_053781All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300034007|Ga0334936_119738Not Available551Open in IMG/M
3300034009|Ga0334944_003311All Organisms → cellular organisms → Bacteria3166Open in IMG/M
3300034024|Ga0334927_005218All Organisms → cellular organisms → Bacteria → Acidobacteria4458Open in IMG/M
3300034026|Ga0334946_000882All Organisms → Viruses → Predicted Viral4686Open in IMG/M
3300034030|Ga0334952_000691All Organisms → cellular organisms → Bacteria → Acidobacteria16361Open in IMG/M
3300034031|Ga0334953_034034All Organisms → cellular organisms → Bacteria → Acidobacteria813Open in IMG/M
3300034135|Ga0334929_001695All Organisms → cellular organisms → Bacteria → Acidobacteria6212Open in IMG/M
3300034135|Ga0334929_037081All Organisms → cellular organisms → Bacteria → Acidobacteria1018Open in IMG/M
3300034137|Ga0334943_009212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1849Open in IMG/M
3300034137|Ga0334943_083427All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300034143|Ga0334961_000528All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes8232Open in IMG/M
3300034143|Ga0334961_006993All Organisms → cellular organisms → Bacteria → Acidobacteria1840Open in IMG/M
3300034143|Ga0334961_018297All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1175Open in IMG/M
3300034144|Ga0334962_004981Not Available1514Open in IMG/M
3300034172|Ga0334913_000065All Organisms → cellular organisms → Bacteria → Acidobacteria101809Open in IMG/M
3300034172|Ga0334913_000170All Organisms → cellular organisms → Bacteria → Acidobacteria49061Open in IMG/M
3300034251|Ga0334947_083467All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300034376|Ga0334923_031596All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1115Open in IMG/M
3300034377|Ga0334931_018973All Organisms → cellular organisms → Bacteria1414Open in IMG/M
3300034377|Ga0334931_042254All Organisms → cellular organisms → Bacteria → Acidobacteria1004Open in IMG/M
3300034392|Ga0334912_039233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4591Open in IMG/M
3300034760|Ga0334948_010092All Organisms → cellular organisms → Bacteria → Acidobacteria2211Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.67%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil11.33%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil10.67%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand10.00%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil8.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.33%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.67%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust4.67%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil4.67%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust3.33%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.33%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave2.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.33%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock1.33%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.33%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots1.33%
Polar DesertEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert0.67%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.67%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.67%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000828Soil microbial communities from Moab, Utah, sample - Soil Crust Dry out, 3 days (biological replicate C) D5C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005607Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012093Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)EnvironmentalOpen in IMG/M
3300012186Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06)EnvironmentalOpen in IMG/M
3300012187Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06)EnvironmentalOpen in IMG/M
3300012188Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06)EnvironmentalOpen in IMG/M
3300012678Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06)EnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300015158Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1A, Ice margin)EnvironmentalOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018890Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, bundles v1EnvironmentalOpen in IMG/M
3300018892Soil crust microbial communities from Colorado Plateau, Utah, USA - early-mid stage, bundles v1EnvironmentalOpen in IMG/M
3300018918Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 0 min after wetting v1EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300018939Soil crust microbial communities from Colorado Plateau, Utah, USA - midlate stage, 9 hrs after wetting v1EnvironmentalOpen in IMG/M
3300018946Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, 0 min after wetting v1EnvironmentalOpen in IMG/M
3300019142Soil crust microbial communities from Colorado Plateau, Utah, USA - mid late stage, 3 min after wetting v1EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300020154Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_20EnvironmentalOpen in IMG/M
3300020202Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10EnvironmentalOpen in IMG/M
3300020215Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5EnvironmentalOpen in IMG/M
3300021067Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20-13CEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300024430Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20EnvironmentalOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027618Polar desert microbial communities from Antarctic Dry Valleys - UQ255 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027766Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300030510Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)EnvironmentalOpen in IMG/M
3300030513Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2)EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300034000Biocrust microbial communities from Mojave Desert, California, United States - 14HMCEnvironmentalOpen in IMG/M
3300034002Biocrust microbial communities from Mojave Desert, California, United States - 16HMCEnvironmentalOpen in IMG/M
3300034005Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 26HNSEnvironmentalOpen in IMG/M
3300034007Biocrust microbial communities from Mojave Desert, California, United States - 32SMCEnvironmentalOpen in IMG/M
3300034009Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 40SMSEnvironmentalOpen in IMG/M
3300034024Biocrust microbial communities from Mojave Desert, California, United States - 23HNCEnvironmentalOpen in IMG/M
3300034026Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 42SMSEnvironmentalOpen in IMG/M
3300034030Biocrust microbial communities from Mojave Desert, California, United States - 48SNCEnvironmentalOpen in IMG/M
3300034031Biocrust microbial communities from Mojave Desert, California, United States - 49SNCEnvironmentalOpen in IMG/M
3300034135Biocrust microbial communities from Mojave Desert, California, United States - 25HNCEnvironmentalOpen in IMG/M
3300034137Biocrust microbial communities from Mojave Desert, California, United States - 39SMCEnvironmentalOpen in IMG/M
3300034143Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNSEnvironmentalOpen in IMG/M
3300034144Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 58SNSEnvironmentalOpen in IMG/M
3300034172Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMSEnvironmentalOpen in IMG/M
3300034251Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 43SMSEnvironmentalOpen in IMG/M
3300034376Biocrust microbial communities from Mojave Desert, California, United States - 19HNCEnvironmentalOpen in IMG/M
3300034377Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNSEnvironmentalOpen in IMG/M
3300034392Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 8HMSEnvironmentalOpen in IMG/M
3300034760Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 44SMSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12467J12023_120325913300000828SoilAAMSESDKCPMGNHPWLATFLVVAFLLVFAAKKLGWL*
Ga0066661_1012266623300005554SoilMSEHGTCPMGRHPWLATFFVLAFVLVFLAHKLGLL*
Ga0066670_1050056723300005560SoilMSEHGKCPMGKHPWPATFFVLAFLLVFLAHKLGLL*
Ga0058697_1028098413300005562AgaveSEHGKCPMGKHPWLATFLVIAFFLVFAAHKLGLL*
Ga0058697_1080022523300005562AgaveMSEHGKCPMGKHPWLATFLVLAFVLIFFAHKLGLL*
Ga0066693_1021899323300005566SoilMSEHGKCPMGKYPWLATFLVLAFVLVFLAHKLGLL*
Ga0070740_10000619473300005607Surface SoilMSEHGKCPMGKHPWLATFFVLAFVLVFIAHKLGLL*
Ga0068852_10063054213300005616Corn RhizosphereMSMSEHDKCPMGKHPWAATFFVLAFVLVFFAHKLGLL*
Ga0081539_10000230923300005985Tabebuia Heterophylla RhizosphereMSTQGKCPMGNHPWLATFLVIAFLLIFAAKKLGLF*
Ga0066696_1095693423300006032SoilMSEHGKCPMGKHPWLATFFVLAFLLVFLAHKLGLL*
Ga0066658_1049828723300006794SoilMSEHGKCPMGKHPWLATFFVLAFVLVFLAHKLGLL*
Ga0066660_1048514023300006800SoilMSEHGKCPMGKHPWLATFLVLAFVLVFVAHKLGLL*
Ga0079216_1066189423300006918Agricultural SoilMSEHGKCPMGKHPWLATFFVLTFLLVFLAHKLGLL*
Ga0105248_1344245513300009177Switchgrass RhizosphereMSEHGKCPMGKYPWLATFFALAFILVFLAHKLGLL*
Ga0126307_1062177623300009789Serpentine SoilSEHGKCPMGKYPWLATFFALAFVLVFLAHKLGLL*
Ga0126307_1102531213300009789Serpentine SoilMSEHGKCPMGKYPRLATFFALAFALIFLAHKLGLL*
Ga0126305_1033039423300010036Serpentine SoilMSEHGKCPMGKYPWLATFFALAFVLVFLAHKLGLL*
Ga0126304_1004386923300010037Serpentine SoilMSEHGKCPMGKYPWLATFFALTFVLVFLAHKLGLL*
Ga0126309_1058941623300010039Serpentine SoilMSEHGKCPMGKYPWAATFFALAFILVFLAHKLGLL*
Ga0126309_1122980623300010039Serpentine SoilMSEHGKCPMGKHPWLATFGTLTFLLVFLAHKLGLL*
Ga0126308_1087188313300010040Serpentine SoilMSEHGKCPMGKHPWLATFFVLAFLLVFFAHKLGLL*
Ga0126308_1094677213300010040Serpentine SoilMSEHGKCPMGTHPWLATFFALAFVLVFLAHKLGLL*
Ga0126312_1042086223300010041Serpentine SoilMSEHGKCPMGKYPWLATFFALAFALVFLAHKLGLL*
Ga0126314_1110500923300010042Serpentine SoilMSEHGKCPMGKHPWLATFFVLAFILIFFAHKLGLL*
Ga0126311_10000352143300010045Serpentine SoilMSEHGKCPMGKYPWLATFLVIAFFLVFAAHKLGLL*
Ga0126311_1032034823300010045Serpentine SoilMSERDKCPMGKHPWLATFGALTFLLVFLAHKLGLL*
Ga0126311_1054135023300010045Serpentine SoilMSERDKCPMGKHPLLATFGVLTFLLVFLAHKLGLL*
Ga0126311_1164043523300010045Serpentine SoilMNEHGKCPMGKYPWLATFFALAFALVFLAHKLGLL*
Ga0126306_1003188933300010166Serpentine SoilMSEHGKCPMGKYPWLATFLAVAFFLVFAAHKLGLL*
Ga0126306_1020054813300010166Serpentine SoilMSEHGKCPMGKYPRLATFFAVAFILVFLAHKLGLL*
Ga0126306_1102466623300010166Serpentine SoilMSEHGKCPMGKYPRLATFFALAFVLVFLALKLGLL*
Ga0136631_1014069523300012043Polar Desert SandVKAMSEEQKCPMGKHPWLATLLAVAFLLVFAAKQLGLI*
Ga0136623_1044443223300012045Polar Desert SandMNDNSKCPMGNHPWLATFLAVAFILLFLSKKFGLL*
Ga0136632_1002097243300012093Polar Desert SandMSEHNKCPMGTHPWLATFLALAFILVFLANKLGLL*
Ga0136632_1012451033300012093Polar Desert SandMYKTMSEENKCPMGKHPWLATFLAVAFLLVFAAKQLGFL*
Ga0136632_1014720523300012093Polar Desert SandMSEEQKCPMGKHPWLATLLAVAFLLVFAAKQLGLI*
Ga0136632_1015066323300012093Polar Desert SandMSDNSKCPMGNHPWLATFLAVAFILLFLSKKFGLL*
Ga0136620_1019345213300012186Polar Desert SandMAEEEGKCPMGKNPRLATFLVVAFVLLFLARKLALW*
Ga0136622_1002879133300012187Polar Desert SandMDEEDKCPMGKRPWLATFLVVAFLLFFLAHKLGVL*
Ga0136622_1033985323300012187Polar Desert SandMAKEEGKCPLGKNPWLATFLVVTFVLLFLARKLALW*
Ga0136618_1005112923300012188Polar Desert SandMCKMMSEENKCPMGKHPWLATFLAVAFLLVFAAKQLGFL*
Ga0136615_1050717213300012678Polar Desert SandMCKTMSEENKCPMGKHPWLATFLAVAFLLVFAAKQLGFL*
Ga0136614_1034322923300012684Polar Desert SandMSDNSKCPMGNHPWLATFLAVAFILLFLSKKLGLL*
Ga0182001_1000003363300014488SoilMSSGGKCPMGKHPWLATMLVVAFLLCVVAKWLGWLY*
Ga0182001_1000044583300014488SoilMAEHGKCPMGKHPWLATFFALAFILGYFAHKLGLL*
Ga0182001_1001405823300014488SoilMSDDGKCPMGKHPWLATFLALAFILTFLASKLGLL*
Ga0182001_1008843413300014488SoilMSEHGKCPMGKHPWLATFGALTFLLVFLAHKLGLL*
Ga0182001_1011230423300014488SoilMSEHGKCPMGNHPWLATFFVLAFLLVFIAHKLGLL*
Ga0182001_1054806323300014488SoilVSEGGKCPMGKHPWLATFLALAFILVFLASKLGLL*
Ga0182001_1062598823300014488SoilMSEHGKCPMGKHPWAATFFVLTFLLVFVAHKLGWL*
Ga0167622_106412123300015158Glacier Forefield SoilENADKCPMGNHPWLATFLALAFILIFVAHKMGLV*
Ga0183260_1006715313300017787Polar Desert SandMAEEEGKCPLGKNPWLATFLVVAFVLLFLARKLALW
Ga0136617_1022154123300017789Polar Desert SandMSEPDKCPMGKYPWLATFLALAFILVFLASKLGLL
Ga0136617_1127606023300017789Polar Desert SandMSEEQKCPMGKHPWLATLLAVAFLLVFAAKQLGLI
Ga0066655_1060836813300018431Grasslands SoilMSEHGKCPMGKYPWLATFLVLAFVLVFLAHKLGLL
Ga0066655_1068626923300018431Grasslands SoilMSEHGKCPMGKHPWLATFFVLAFLLVFLAHKLGLL
Ga0190275_1151318823300018432SoilMSEHGKCPMGNHPWAASFFVLTFLLVFVAHKLGLL
Ga0190269_1007415823300018465SoilMAEHGKCPMGNHPWLATFFALAFILGYLAHKLGLL
Ga0190269_1040564723300018465SoilMSEHGKCPMGKHPWLATFGALTFLLVFLAHKLGLL
Ga0190269_1070459323300018465SoilMSEHGKCPMGKHPWLATFGVLTFLLVFVAHKLGLL
Ga0190268_1073090323300018466SoilMADESKCPMGRHAWLATFLVVAFVLLFFSRKLGLL
Ga0190268_1104692423300018466SoilMAEEEGKCPMGKNPWLATFLVVAFVLLFLAHKLGLV
Ga0190268_1124825413300018466SoilMREHGKCPMGKHPWLATFFALTFLLVFLAHKLGLL
Ga0066662_1002605633300018468Grasslands SoilMSEHGTCPMGRHPWLATFFVLAFVLVFLAHKLGLL
Ga0066662_1060230113300018468Grasslands SoilMSEHGKCPMGKHPWPATLFVLAFLLVFLAHKLGLL
Ga0066662_1103892423300018468Grasslands SoilMSEHGKCPMGKHPWLATFLVLAFVLVFVAHKLGLL
Ga0066662_1132573813300018468Grasslands SoilMSEHGKCPMGKHPWLATFLVLAFILVFLAHKLGLL
Ga0066662_1198651223300018468Grasslands SoilMSEHGKCPMGNHPWLATFFVLAFILVLVAHKLGLL
Ga0193595_104541823300018890SoilMSEHGKCPMGKHPWLATFFVLTFLLVFLAHKLGLL
Ga0193607_1000752153300018892SoilMNESDKCPMGNHPWLATFLVVAFLLVFAAKKLGWL
Ga0193616_110713523300018918SoilMSEHGKCPMGKHPWLATFFALTFVLVFLAHKLGLL
Ga0190273_1054753823300018920SoilMSESGKCPMGKHPWLATMLVIAFFLVFIAKSLGWLY
Ga0190273_1108176313300018920SoilMSDDGKCPMGKHPWLATFLALAFILTFLASKLGLL
Ga0190273_1113156813300018920SoilMNEPGKCPMGKYPWLATFLVIAFFLVFAAHKLGLL
Ga0190273_1138685723300018920SoilMSEHGKCPMGNHPRLATFFVFTFLLVFLAHKLGLL
Ga0193593_100139023300018939SoilMSESDKCPMGNHPWLATFLVVAFLLVFAAKKLGWL
Ga0193599_100304023300018946SoilMAEHGKCPMGNHPWLATFFALAFILVFAAHKLGLL
Ga0193597_1000118313300019142SoilMSESEKCPMGNHPWLATFLVVAFLLVFAAKKLGWL
Ga0190264_1234033223300019377SoilMSDDGKCPMGKHPWLATFLALAFILTYAASKLGLL
Ga0190267_1039244623300019767SoilMSEHGKCPMGKHPWLATFLALAFILVFLASKLGFI
Ga0190267_1098798323300019767SoilMSERDKCPMGKHPWLATFGALTFLLVFLAHKLGLL
Ga0190267_1124192223300019767SoilMSEHGKCPMGKHPWLATFGVLTFLLVFLAHKLGML
Ga0190267_1136741123300019767SoilMSDGGKCPLGKNAWLATFLVVAFVLLFLSRKLGLL
Ga0190267_1152334713300019767SoilMAEDEGKCPMGKNPWLATFLLVAFLLIFLAKKLGLL
Ga0190267_1155029213300019767SoilPYTQHPMSMSEHGKCPMGKYPWLATFFALAFVLVFLAHKLGLL
Ga0190267_1162784713300019767SoilMSEHGKCPMGKHPWLATFLVVAFFLVFAAHKLGLL
Ga0196977_1000180233300020146SoilMSEGGKCPMGRHPWLATFLALAFALAFLASKLGLL
Ga0196977_104498323300020146SoilMSEHGKCPMGKHPWVATFFVLAFVLIFFAHKLGLL
Ga0196977_104890823300020146SoilMSGGGKCPMGKHPWLAAFLALAFVLVFMASKLGLL
Ga0196965_104428123300020154SoilMADEGKCPMGRHAWLATFLVVAFVLLFFSKKLGLL
Ga0196964_1002553653300020202SoilMSEGGKCPMGKHAWLATFLVVAFVLMFLSRKLGLL
Ga0196964_1020689823300020202SoilMSEHGKCPMGRHPWLATFFVLAFVLVFLAHKLGLL
Ga0196964_1022707923300020202SoilVSEGGNKCPMGKNPWLATFLALAFVLTYLASKLGLL
Ga0196963_1002878043300020215SoilMSERGKCPMGNHPWLATFLALAFILVFLASKLGLL
Ga0196963_1023886813300020215SoilMTEGGKCPMGKHPWLATFLALAFILTFLASKFGLL
Ga0196963_1029428123300020215SoilMSEHGKCPMGKHPWLATFFVLAFVLIFFAHKLGLL
Ga0196978_10000044393300021067SoilMSEQGKCPMGKHPWVATFFVLAFVLIFFAHKLGLL
Ga0213882_1037737113300021362Exposed RockPGTQHPMSLSEHGKCPMGKHPWLATFLVLAFVLVFLAHKLGLL
Ga0213881_1026851323300021374Exposed RockMSEGGKCPMGKHPWLATMLVVAFFLCVIAKWLGWLY
Ga0213876_1000047923300021384Plant RootsMSLSEHGKCPMGKHPWLATFLVLAFVLVFLAHKLGLL
Ga0213876_1000221933300021384Plant RootsMSEHGKCPMGKHPWVATFFVLAFILIFFAHKLGLL
Ga0182009_1024347923300021445SoilMSEHGKCPMGKYPWLATFFALAFILVFLAHKLGLL
Ga0196962_1007883533300024430SoilMGEAAVSEGGKCPMGKHPWLATFLALAFALVFLASKLGLL
Ga0207698_1185630723300026142Corn RhizosphereMSMSEHDKCPMGKHPWAATFFVLAFVLVFFAHKLGLL
Ga0209153_100061423300026312SoilMSNGNKCPMGKHPWLATFLVIAFLLIFAAKKLGLF
Ga0209153_131329913300026312SoilMSDGNKCPMGKYPWLATFLVIAFLLIFAAKKLGLF
Ga0209152_1018341823300026325SoilMSEHGKCPMGKHPWPATFFVLAFLLVFLAHKLGLL
Ga0209577_1035606623300026552SoilMSEHGKCPMGKHPWLATFLVLAFVLVFLAHKLGLL
Ga0209577_1043004313300026552SoilMSEHDKCPMGKHPWLATFFVLAFVLVFLAHKLGLL
Ga0208736_116751823300027618Polar DesertMNDNSKCPMGNHPWLATFLAVAFILLFLSKKFGLL
Ga0209581_100111383300027706Surface SoilMSEHGKCPMGKHPWLATFFVLAFVLVFIAHKLGLL
Ga0209461_1000404633300027750AgaveMNEHGKCPMGKHPWLATFFVLAFVLVFLAHKLGLL
Ga0209796_1025265313300027766AgaveMSEHGKCPMGKHPWAATFFVLAFLLVFLAHKLGLL
Ga0268243_105284023300030510SoilMSEHGKCPMGKHPWLATFFVLAFVLVFLAHKLGLL
Ga0268242_100002763300030513SoilMSSGGKCPMGKHPWLATMLVVAFLLCVVAKWLGWLY
Ga0268242_100478833300030513SoilMAEHGKCPMGKHPWLATFFALAFILGYFAHKLGLL
Ga0307405_1121494423300031731RhizosphereMSMSEHGKCPMGKYPWLATFFALAFVLVFLAHKLGLL
Ga0307468_10022823423300031740Hardwood Forest SoilMSEHGKCPMGKHPWLATFFVLAFFLVFAAHKLGLL
Ga0307410_1061067123300031852RhizosphereMSMSEHGKCPMGKYPRLATFFVLAFVLVFLAHKLGLL
Ga0307406_1195221123300031901RhizosphereMSEHGKCPMGKHPWLATFFALAFILVFLAHKLGLL
Ga0307409_10123360023300031995RhizosphereSMSEHGKCPMGKYPWLATFFALAFVLVFLAHKLGLL
Ga0307415_10054108213300032126RhizosphereMSEHGKCPMGKYPWLATFFALAFVLVFLAHKLGLL
Ga0334918_014115_117_2273300034000Hypolithic BiocrustMEEGNKCPMGNHPWLATFLVVAFILCFIASKLGWLY
Ga0334918_044632_416_5233300034000Hypolithic BiocrustMSEHGKCPMGKHPWVATFFVLAFLLVFLAHKLGLL
Ga0334920_000054_8936_90433300034002Hypolithic BiocrustMSEHGKCPMGKHPWAATFFVLTFLLVFLAHKLGLL
Ga0334930_016575_842_9493300034005Sub-Biocrust SoilMSENDKCPMGKHPWLATFGVLTFLLVFLAHKLGLL
Ga0334930_051026_166_2763300034005Sub-Biocrust SoilMGEEGGKCPMGKNPWLATFLLLAFILILLGKKLGLL
Ga0334930_053781_422_5293300034005Sub-Biocrust SoilMSERGKCPMGNHPWAATFFVLTFLLVFVAHKLGWL
Ga0334936_119738_385_4923300034007BiocrustMAEHGKCPMGNHPWLATFFALAFILVFLAHKLGLL
Ga0334944_003311_1710_18173300034009Sub-Biocrust SoilMSEHGKCPMGKHPWLATFFVLTFLLVFAAHKLGLL
Ga0334927_005218_2766_28733300034024Hypolithic BiocrustMSEHGKCPMGKYPRLATFFALAFVLVFLAHKLGLL
Ga0334946_000882_2347_24543300034026Sub-Biocrust SoilMSEHGKCPMGNHPWLATFFVLTFLLVFAAHKLGLL
Ga0334952_000691_3166_32733300034030BiocrustMSEHGKCPMGKHPWLATFFVLTFLLVFAAHKLGML
Ga0334953_034034_95_2023300034031BiocrustMSENGKCPMGKHPWLATFFVLTFLMVFLAHKLGLL
Ga0334929_001695_3390_34973300034135Hypolithic BiocrustMSEHGKCPMGKHPWLATFFVLTFLLVFIAHKLGLL
Ga0334929_037081_123_2303300034135Hypolithic BiocrustMSEHGKCPMGKYPWLATFFALAFVLVFFAHKLGLL
Ga0334943_009212_1379_14863300034137BiocrustMSEHGKCPMGKHPWAATFFVLTFLLVFVAHKLGWL
Ga0334943_083427_73_1803300034137BiocrustMSEESKCPMGKYPRLAAFLALAFILLFLSKKFGLL
Ga0334961_000528_4205_43153300034143Sub-Biocrust SoilVSEGGKCPMGKHPWLATMLVVAFLLCFIAKSLGWLY
Ga0334961_006993_322_4593300034143Sub-Biocrust SoilVRARGNLGGAVSEGGKCPMGNHPWLATFLALAFVLVFLASKLGLL
Ga0334961_018297_869_9763300034143Sub-Biocrust SoilMSEHGKCPMGNHPWLATFFALAFVLVFLAHKLGLL
Ga0334962_004981_1305_14153300034144Sub-Biocrust SoilMTEEGGKCPMGKNPWLATFLVVAFVLLFLAHQLGLM
Ga0334913_000065_77023_771303300034172Sub-Biocrust SoilMGDGGKCPMGKHPWLATFLLLAFLLVVAAKKLGLI
Ga0334913_000170_42160_422703300034172Sub-Biocrust SoilMAEEGGKCPMGKNPWLATFLVVAFILIFAAKKLGLF
Ga0334947_083467_507_6143300034251Sub-Biocrust SoilMREPDKCPMGKHPWLATFFALTFMLVFLAHKLGLL
Ga0334923_031596_802_9093300034376Hypolithic BiocrustMNEHGKCPMGNHPWLATFFALAFILVFLAHKLGLL
Ga0334931_018973_1166_12763300034377Sub-Biocrust SoilMSESGKCPMGKHPWLATMLVVAFFLVFIAKSLGWLY
Ga0334931_042254_407_5143300034377Sub-Biocrust SoilMSEENRCPMGNHPWLATFLALAFILLFLAKKLGLL
Ga0334912_039233_193_3003300034392Sub-Biocrust SoilLSEGAKCPMGKYPWLATFLALAFFLVFIASKLGLL
Ga0334948_010092_888_9953300034760Sub-Biocrust SoilMSDDGKCPMGKHPWLATFLALAFILTFLASKFGLL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.