Scaffold Ga0272380_10810011

Overview

Basic Information

• Taxon OID: 3300029959
• Scaffold ID: Ga0272380_10810011
• Source Dataset Name: EPA Superfund site combined assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 589
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico

Source Dataset Sampling Location

• Location Name: Espanola, New Mexico, United States
• Coordinates
  • Lat. (^o): 35.992
  • Long. (^o): -106.0797

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053932	Metagenome / Metatranscriptome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0272380_108100111	F053932	GAGG	MHRWLPHVLFPRPGWFVLHAAAIVLVFLLGYSVKF