| Basic Information | |
|---|---|
| Taxon OID | 3300029948 Open in IMG/M |
| Scaffold ID | Ga0119873_1052397 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial communities from Shatin wastewater treatment plant, Hong Kong - ST_Foam_2012.3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Hong Kong |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 535 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Communities From Shatin Wastewater Treatment Plant, Hong Kong |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011936 | Metagenome / Metatranscriptome | 285 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119873_10523972 | F011936 | AGGGGG | LDELSITGRMQRLESDHNMLVRDYSRLNDAIVKISESLTQLVVIQEQNKAIMACIERQQMSIDKLDARLDVLEVQQPQLLELRSWVLTWLGLIISAVLVAIIALVLK |
| ⦗Top⦘ |