NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0311340_10845850

Scaffold Ga0311340_10845850


Overview

Basic Information
Taxon OID3300029943 Open in IMG/M
Scaffold IDGa0311340_10845850 Open in IMG/M
Source Dataset NameI_Palsa_N3 coassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)766
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa → Peat Permafrost Microbial Communities From Stordalen Mire Near Abisko, Sweden

Source Dataset Sampling Location
Location NameSweden: Abisko, Stordalen Mire
CoordinatesLat. (o)68.3535Long. (o)19.0473Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017180Metagenome / Metatranscriptome242Y
F025552Metagenome / Metatranscriptome201Y
F080310Metagenome / Metatranscriptome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0311340_108458501F080310AGAAGMPDPGHPPGVSELTSGELERTRRDLAVSLALVRPGSPALVPIQAHLTAIDGELAQRTGQQ
Ga0311340_108458502F017180AGGAMPTTATEPETTPAGQPPKVDPPKHPLRALTTFELRNYRRQLENAITFFDKQEPVPPVRDDLQATLDTVLAEQDDRQKIANA
Ga0311340_108458503F025552N/AIAETDSYGMLCEDWGSAYLITRTPGTVNPYQAERRDDPAAVLQAATPGALREMIRADYFARPVPREIAP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.