| Basic Information | |
|---|---|
| Taxon OID | 3300029929 Open in IMG/M |
| Scaffold ID | Ga0119938_10570 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Treated_water_201207 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Hong Kong |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1037 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant → Freshwater Microbial Communities From Drinking Water Treatment Plant - The University Of Hong Kong |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000325 | Metagenome / Metatranscriptome | 1296 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119938_105703 | F000325 | GGAG | MKVANGNDKLGKGCLVVSRPVGDTCPSSCAFLGNGCYAEQTEKMYPNVRPAGLQNVITEKNRIRAMILDAVRQGKSIRWHERGDWFLNGTLDTDYVSNVTDACESILASGGTLPDMWFYTHIYDSRLVSLEKYMAVYASVHNAADKAAAVAAGFKLFAWCDSDTKIAPKRPKRKAAADAWRNSLPKLVVIDDTKY |
| ⦗Top⦘ |