3300029929: Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Treated_water_201207

Overview

Basic Information

• IMG/M Taxon OID: 3300029929
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118588 | Gp0137292 | Ga0119938
• Sample Name: Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Treated_water_201207
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Hong Kong
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 9891232
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	1
All Organisms → Viruses → Predicted Viral	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Freshwater Microbial Communities From Drinking Water Treatment Plant - The University Of Hong Kong
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant → Freshwater Microbial Communities From Drinking Water Treatment Plant - The University Of Hong Kong

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater biome → water treatment plant → drinking water
• Earth Microbiome Project Ontology (EMPO): Unclassified

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000325	Metagenome / Metatranscriptome	1296	Y
F074795	Metagenome	119	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0119938_10474	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	1318
Ga0119938_10570	All Organisms → Viruses → Predicted Viral	1037

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0119938_10474	Ga0119938_104743	F074795	VTKEQAIIKILKVLKSPMMVMNVYNRDEALTLAEEYGITAKDLIEEWTRIAERI
Ga0119938_10570	Ga0119938_105703	F000325	MKVANGNDKLGKGCLVVSRPVGDTCPSSCAFLGNGCYAEQTEKMYPNVRPAGLQNVITEKNRIRAMILDAVRQGKSIRWHERGDWFLNGTLDTDYVSNVTDACESILASGGTLPDMWFYTHIYDSRLVSLEKYMAVYASVHNAADKAAAVAAGFKLFAWCDSDTKIAPKRPKRKAAADAWRNSLPKLVVIDDTKY