Basic Information | |
---|---|
Taxon OID | 3300029905 Open in IMG/M |
Scaffold ID | Ga0247327_1029964 Open in IMG/M |
Source Dataset Name | Fecal microbial communities from Fat line chicken in Harbin, China - MGJ17 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Inner Mongolia Agricultural University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1415 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Birds → Digestive System → Fecal → Unclassified → Fecal → Fecal Microbial Communities From Lean And Fat Line Chickens In Harbin, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Harbin | |||||||
Coordinates | Lat. (o) | 45.73 | Long. (o) | 126.73 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F047755 | Metagenome | 149 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0247327_10299641 | F047755 | N/A | GNLNMENEKVKYLINMINDMDIKNKLRLAICMSKSEWSGLIYNTKENYEKFDNMLKSIDEEYRTTLINFGKYKLVMFAMAKLMEMQATEQNQVALFLFNDVNTIIAKEKYYTG |
⦗Top⦘ |