| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029905 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133372 | Gp0289966 | Ga0247327 |
| Sample Name | Fecal microbial communities from Fat line chicken in Harbin, China - MGJ17 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Inner Mongolia Agricultural University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 235732452 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → Viruses | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Fecal Microbial Communities From Lean And Fat Line Chickens In Harbin, China |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Birds → Digestive System → Fecal → Unclassified → Fecal → Fecal Microbial Communities From Lean And Fat Line Chickens In Harbin, China |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | China: Harbin | |||||||
| Coordinates | Lat. (o) | 45.73 | Long. (o) | 126.73 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047755 | Metagenome | 149 | Y |
| F053097 | Metagenome / Metatranscriptome | 141 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0247327_1029964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1415 | Open in IMG/M |
| Ga0247327_1055416 | All Organisms → Viruses | 850 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0247327_1029964 | Ga0247327_10299641 | F047755 | GNLNMENEKVKYLINMINDMDIKNKLRLAICMSKSEWSGLIYNTKENYEKFDNMLKSIDEEYRTTLINFGKYKLVMFAMAKLMEMQATEQNQVALFLFNDVNTIIAKEKYYTG |
| Ga0247327_1055416 | Ga0247327_10554162 | F053097 | MFDIKGSKIVFSTEDLAIPPFRDFYNNAKDKNLAKKQLEYVIWTYKWNSPYEAYPENERPQRVAQDVFGTDYEPDADVKELIKRFNEF |
| ⦗Top⦘ |