| Basic Information | |
|---|---|
| Taxon OID | 3300029904 Open in IMG/M |
| Scaffold ID | Ga0247319_1000077 Open in IMG/M |
| Source Dataset Name | Fecal microbial communities from Lean line chicken in Harbin, China - MGJ1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Inner Mongolia Agricultural University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 98224 |
| Total Scaffold Genes | 170 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 61 (35.88%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Birds → Digestive System → Fecal → Unclassified → Fecal → Fecal Microbial Communities From Lean And Fat Line Chickens In Harbin, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Harbin | |||||||
| Coordinates | Lat. (o) | 45.73 | Long. (o) | 126.73 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053097 | Metagenome / Metatranscriptome | 141 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247319_1000077150 | F053097 | N/A | MFDIKGDKIVFSTQDLAIPPFKDFYNNAKDKNLAKKQLEYVVWRYKWNTPYEAYPENERSERVALDVFGAKYEPDASVKELIKRFNEF |
| ⦗Top⦘ |