| Basic Information | |
|---|---|
| Taxon OID | 3300029897 Open in IMG/M |
| Scaffold ID | Ga0247036_1044337 Open in IMG/M |
| Source Dataset Name | Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-B2b |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DMAC, Technical University of Denmark |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 961 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Greenland: Tasiilaq | |||||||
| Coordinates | Lat. (o) | 65.38 | Long. (o) | -38.53 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F035524 | Metagenome / Metatranscriptome | 172 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247036_10443372 | F035524 | N/A | MQLDFQLHFPLVNRVAQIRKLPYSLVILREGLYSVSVHKLPLVEYFVFFDSPMKSEQMKLKFYKTAEGKWYDKSYSEEAELNSPEFGIPQMNTGLKAVIDMYESQHMQQKSFSH |
| ⦗Top⦘ |