Scaffold Ga0247036_1041172

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247036_1041172

Scaffold Ga0247036_1041172

Overview

Basic Information
Taxon OID	3300029897 Open in IMG/M
Scaffold ID	Ga0247036_1041172 Open in IMG/M
Source Dataset Name	Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-B2b
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DMAC, Technical University of Denmark
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1024
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet

Source Dataset Sampling Location
Location Name	Greenland: Tasiilaq
Coordinates	Lat. (^o)	65.38	Long. (^o)	-38.53	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077506	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247036_10411721	F077506	GAGG	VIDLSERTRRISGSRLLEILQTYDAKSVIDPFMGYPAHLNFLKRHGIAVHGGDLVDWFVRAGEGLVVNDLTILRDSEVAEIVEMLPGRIYPIDLFKGWDGVFFTEEQCIYLGVWHSNVHNLRSDGQTGLAIAGLWHVLCYWLQKSKYPDDMADLPPSELAWNYIRETEHLVTQNAQRNTVRRGDFNATLGSIQADAVFIAPPGRNAHKKADARVWMWEAWWQGDPYLNIEG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.