Scaffold Ga0247036_1036851

Overview

Basic Information

• Taxon OID: 3300029897
• Scaffold ID: Ga0247036_1036851
• Source Dataset Name: Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-B2b
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DMAC, Technical University of Denmark
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1130
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 44-15 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite → Cryconite Microbial Communities Around The Greenland Ice Sheet

Source Dataset Sampling Location

• Location Name: Greenland: Tasiilaq
• Coordinates
  • Lat. (^o): 65.38
  • Long. (^o): -38.53

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075379	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247036_10368513	F075379	N/A	MQLTSKTTGQDEKLDGLLSLLMREYEDFPTIPLEGFYDRYSEFFGEELHHLQEVLFDDELVRCFVGPEGLEMEITQKGIGFMAKGGYSREIREEMICHDDALRAQKNNRLWNTLVAIGFVAAIIICFYIRHKSI