Scaffold Ga0246100_133406

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0246100_133406

Scaffold Ga0246100_133406

Overview

Basic Information
Taxon OID	3300029891 Open in IMG/M
Scaffold ID	Ga0246100_133406 Open in IMG/M
Source Dataset Name	Groundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig2158
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, Berkeley
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	769
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan

Source Dataset Sampling Location
Location Name	Japan: Horonobe URL
Coordinates	Lat. (^o)	45.045278	Long. (^o)	141.859444	Alt. (m)		Depth (m)	250
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083668	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0246100_1334063	F083668	AGGAG	MKKWSPDKITAVILIVGCFGLLFTGIDGEVKAILTIAAGYLFGTSIIERKK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.