| Basic Information | |
|---|---|
| Taxon OID | 3300029824 Open in IMG/M |
| Scaffold ID | Ga0134852_101026 Open in IMG/M |
| Source Dataset Name | Liquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-1-30-B |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chongqing University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1795 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Chengdu | |||||||
| Coordinates | Lat. (o) | 30.65 | Long. (o) | 104.06 | Alt. (m) | Depth (m) | .01 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010099 | Metagenome / Metatranscriptome | 308 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134852_1010261 | F010099 | N/A | MTYSQSSFWTPARIGAVIGAVLLIVALAYLVSLPQNQFQPADLLEPTYAADADLGYWMVDKYDQEVDVYHLLVVMEHPNGTYEWLDGDGIWL |
| ⦗Top⦘ |