| Basic Information | |
|---|---|
| Taxon OID | 3300029821 Open in IMG/M |
| Scaffold ID | Ga0246092_1047086 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig3392 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, Berkeley |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 695 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Japan: Horonobe URL | |||||||
| Coordinates | Lat. (o) | 45.045278 | Long. (o) | 141.859444 | Alt. (m) | Depth (m) | 215 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F069747 | Metagenome | 123 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0246092_10470861 | F069747 | N/A | MNKQGRFLDSLTARQYGEVVLPDVSTGKSPGTLAGKLSRCKEGMARVFAVMVQILLRAGALALQV |
| ⦗Top⦘ |