| Basic Information | |
|---|---|
| Taxon OID | 3300029797 Open in IMG/M |
| Scaffold ID | Ga0243129_1038314 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from Yellow Sea, Weihai, China - HGD.2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Shandong University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1754 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → unclassified Caldithrix → Caldithrix sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Sediment → Sediment Microbial Communities From Yellow Sea, Weihai, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Weihai | |||||||
| Coordinates | Lat. (o) | 37.31 | Long. (o) | 122.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020363 | Metagenome / Metatranscriptome | 224 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0243129_10383141 | F020363 | N/A | MWRWRRVAVARVFALVVRCRIMLLLVYSRVGKNRDTRRGSPAGAGAGRTADHFTVLFSQKILAVRKANDIYRPVRASFYSQKFFNISFYVA |
| ⦗Top⦘ |