Scaffold Ga0242825_1020483

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0242825_1020483

Scaffold Ga0242825_1020483

Overview

Basic Information
Taxon OID	3300029790 Open in IMG/M
Scaffold ID	Ga0242825_1020483 Open in IMG/M
Source Dataset Name	Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 015_6_4_stool_1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Institute for Genome Sciences, University of Maryland School of Medicine
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1469
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa

Source Dataset Sampling Location
Location Name	USA: Baltimore
Coordinates	Lat. (^o)	39.28846264	Long. (^o)	-76.62594594	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076190	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0242825_10204831	F076190	N/A	VRTAGGSITISVKNVFTAASRVSGRVWSLVRITVPNDLKFVRIRVEKP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.