Scaffold Ga0243204_1000197

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0243204_1000197

Scaffold Ga0243204_1000197

Overview

Basic Information
Taxon OID	3300029780 Open in IMG/M
Scaffold ID	Ga0243204_1000197 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from healthy subjects in Hangzhou, China - HD-40_Run3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Zhejiang University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	85465
Total Scaffold Genes	114 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	23 (20.18%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China

Source Dataset Sampling Location
Location Name	China: Hangzhou
Coordinates	Lat. (^o)	30.0	Long. (^o)	120.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089054	Metagenome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0243204_100019729	F089054	N/A	MLTLGKFLVSFEVPGPLPGTTEGFCEEMNVVYRTEELNTYLRYPKQQINPWHKHSTYIRLKLREILKVNLTDITIIDIISLP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.