Scaffold Ga0134843_1010977

Overview

Basic Information

• Taxon OID: 3300029775
• Scaffold ID: Ga0134843_1010977
• Source Dataset Name: Liquor fermentation pit mud microbial communities from Luzhou, China - Meta-4-1-220-B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chongqing University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2551
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China

Source Dataset Sampling Location

• Location Name: China: Luzhou
• Coordinates
  • Lat. (^o): 28.88
  • Long. (^o): 105.45
  • Depth (m): .01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103498	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134843_10109772	F103498	GAGG	MDNTETCELQHCRLRTDILCEVQRREEKQDERFLALIEELRHDWKETKKEVTSIKDTMIQGFIALIVAVIGVYVSYLLLNVIGFI