NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134843_1007244

Scaffold Ga0134843_1007244


Overview

Basic Information
Taxon OID3300029775 Open in IMG/M
Scaffold IDGa0134843_1007244 Open in IMG/M
Source Dataset NameLiquor fermentation pit mud microbial communities from Luzhou, China - Meta-4-1-220-B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChongqing University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3913
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Methanogenium → Methanogenium cariaci(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China

Source Dataset Sampling Location
Location NameChina: Luzhou
CoordinatesLat. (o)28.88Long. (o)105.45Alt. (m)Depth (m).01
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010099Metagenome / Metatranscriptome308Y

Sequences

Protein IDFamilyRBSSequence
Ga0134843_10072443F010099AGCAGGMHNSRLPLSDAVLVITYKYPLPLFSHMTDAKTSFWTPARIGAVIGAVLLVVLLAYAASLPQNKFEDGDLLEPKYAADADLGYWMVDKYDQEVDVYHLLVVMEHPNGTFEWLDGDGIWLPRRAVEGTFTVIGTFDARKANL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.