Scaffold Ga0245161_107209

Overview

Basic Information

• Taxon OID: 3300029744
• Scaffold ID: Ga0245161_107209
• Source Dataset Name: Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_36674
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3555
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Twins In The Twinsuk Registry In London, United Kingdom

Source Dataset Sampling Location

• Location Name: United Kingdom: London
• Coordinates
  • Lat. (^o): 51.5
  • Long. (^o): -0.12

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067845	Metagenome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0245161_1072092	F067845	GGA	LSACWLGSVNTGTDAEKAAELAQQLGIAHTQELDNTAKAVAEWFVQEPDSLRVSGLDLVYTVALDADSNMGYTGDLNKFLYWSGCYGVPEDVTVALLLDDSTAMTAQLYAPQADSAAAELLEDAAGHSELGAAFIDYNGTAYVVAVFR