Scaffold Ga0257138_1050928

Overview

Basic Information

• Taxon OID: 3300029689
• Scaffold ID: Ga0257138_1050928
• Source Dataset Name: Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_55m (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 621
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: Canada: British Columbia
• Coordinates
  • Lat. (^o): 49.68
  • Long. (^o): -124.009
  • Depth (m): 55

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035608	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257138_10509282	F035608	N/A	GSLTPLLATVTSIYCPRLPENAALPAVSFFTRGGVNNPYIPGMLEPSVQFDCWAGTPIAARKIYRALYDNLQGIQGKVVTVGPPSEIIWSAIEEVQGQDLVDVEIPNYFRTLVFFRFVIKAE