Scaffold Ga0243361_118205

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0243361_118205

Scaffold Ga0243361_118205

Overview

Basic Information
Taxon OID	3300029672 Open in IMG/M
Scaffold ID	Ga0243361_118205 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from liver cirrhosis patients in Hangzhou, China - LD-47_Run3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Zhejiang University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	846
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Healthy And Liver Cirrhosis Patients In Hangzhou, China

Source Dataset Sampling Location
Location Name	China: Hangzhou
Coordinates	Lat. (^o)	30.0	Long. (^o)	120.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090515	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0243361_1182051	F090515	GAG	MITCCKVGPKTALQGTAPGRVACLEFAGGEKRKTNIAADYAVKALAFTALLCRHIGSIRTFLKS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.