NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0238865_11859

Scaffold Ga0238865_11859


Overview

Basic Information
Taxon OID3300029631 Open in IMG/M
Scaffold IDGa0238865_11859 Open in IMG/M
Source Dataset NameSeawater microbial communities from Ross Sea, Antarctic Ocean - 124LC-38360620
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterInstitute for Systems Biology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)720
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Seawater → Seawater Microbial Communities From Ross Sea, Antarctic Ocean

Source Dataset Sampling Location
Location NameSouthern Ocean: Ross Sea
CoordinatesLat. (o)-76.4986Long. (o)-179.9884Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023242Metagenome211Y

Sequences

Protein IDFamilyRBSSequence
Ga0238865_118592F023242N/AMKDDFRPSAAQPNPPEDKRTYTTHKEHGEDMSHENETTITSEPREDRGALDLTFLIEEHKKQIWDYKRKESEWIKTDNILQGSKKIIDELSTKLVGLARRIQELEYDNATYKKEIEKMLADKKV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.