Basic Information | |
---|---|
Taxon OID | 3300029631 Open in IMG/M |
Scaffold ID | Ga0238865_11859 Open in IMG/M |
Source Dataset Name | Seawater microbial communities from Ross Sea, Antarctic Ocean - 124LC-38360620 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Institute for Systems Biology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 720 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Seawater → Seawater Microbial Communities From Ross Sea, Antarctic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Southern Ocean: Ross Sea | |||||||
Coordinates | Lat. (o) | -76.4986 | Long. (o) | -179.9884 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023242 | Metagenome | 211 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0238865_118592 | F023242 | N/A | MKDDFRPSAAQPNPPEDKRTYTTHKEHGEDMSHENETTITSEPREDRGALDLTFLIEEHKKQIWDYKRKESEWIKTDNILQGSKKIIDELSTKLVGLARRIQELEYDNATYKKEIEKMLADKKV |
⦗Top⦘ |