| Basic Information | |
|---|---|
| Taxon OID | 3300029631 Open in IMG/M |
| Scaffold ID | Ga0238865_11073 Open in IMG/M |
| Source Dataset Name | Seawater microbial communities from Ross Sea, Antarctic Ocean - 124LC-38360620 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Institute for Systems Biology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1286 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Seawater → Seawater Microbial Communities From Ross Sea, Antarctic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Ocean: Ross Sea | |||||||
| Coordinates | Lat. (o) | -76.4986 | Long. (o) | -179.9884 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052205 | Metagenome / Metatranscriptome | 143 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0238865_110733 | F052205 | AGGA | MSLSNQDIDELFDGKPSELTYSQWLTIEGNIDFTSLTTTMKADILNRINDLSEEEAEVIITKLYNNRYEKDPQKQWLRMLKDGVFNYRDF |
| ⦗Top⦘ |