Scaffold Ga0238865_10126

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0238865_10126

Scaffold Ga0238865_10126

Overview

Basic Information
Taxon OID	3300029631 Open in IMG/M
Scaffold ID	Ga0238865_10126 Open in IMG/M
Source Dataset Name	Seawater microbial communities from Ross Sea, Antarctic Ocean - 124LC-38360620
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Institute for Systems Biology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	15720
Total Scaffold Genes	32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	17 (53.12%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Seawater → Seawater Microbial Communities From Ross Sea, Antarctic Ocean

Source Dataset Sampling Location
Location Name	Southern Ocean: Ross Sea
Coordinates	Lat. (^o)	-76.4986	Long. (^o)	-179.9884	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065121	Metagenome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0238865_1012617	F065121	N/A	MIKTLIVLILLFNGKVVKEKLYFAKPVTILECLEFADQHMEDIATHFWVKNVMKSGYYLNDGRGTIQGFVCE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.