| Basic Information | |
|---|---|
| Taxon OID | 3300029607 Open in IMG/M |
| Scaffold ID | Ga0244907_119458 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from Shanghai, China - P025V1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1374 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → environmental samples → Firmicutes bacterium CAG:321 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Shanghai | |||||||
| Coordinates | Lat. (o) | 31.2112312 | Long. (o) | 121.4647709 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068941 | Metagenome | 124 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0244907_1194582 | F068941 | N/A | VSLKEQYLDKGVERMDNKKFIIGVILLLLLMIGGTYAYYKWSSSDNMNVNVKIDGGTVTFDGGTNITSTIMPTATKEEGIKKDITVKASKEGVTINLYMDLTTIPSELKEKSFEYEIYYNGTTLVKKGNFGVYNSNTNTSGISYATSGXXXXTLFTGRDVSTSNTDKYTLYLWFNGKDYTNPNTMQSKKLSFDLYATGENAVLAGN |
| ⦗Top⦘ |