Scaffold Ga0242783_108972

Overview

Basic Information

• Taxon OID: 3300029606
• Scaffold ID: Ga0242783_108972
• Source Dataset Name: Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 008_6_16_stool_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Institute for Genome Sciences, University of Maryland School of Medicine
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2784
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa

Source Dataset Sampling Location

• Location Name: USA: Baltimore
• Coordinates
  • Lat. (^o): 39.28846264
  • Long. (^o): -76.62594594

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056309	Metagenome	137	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0242783_1089724	F056309	N/A	STVKGTKRTCLRRTPSLSVVPLLLGDFDSLSVSYGMEPEQEALSIVSFKD